Details |
ISAGMPMOVW-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: T000 Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
ISAGMPMOVW-LEDGER table field - Ledger in General Ledger Accounting
▼
Description: Ledger in General Ledger Accounting Field Name: LEDGER Data Element: FINS_LEDGER Data Type: CHAR length (Dec): 2(0) Check table: FINSC_LEDGER Conversion Routine: ALPHA Domain Name: FINS_LEDGER MemoryID: GLN_FLEX AppClass: SHLP: FINS_LEDGER SHLP Field: RLDNR ConvExit: ALPHA See all SAP tables containing field LEDGER
|
ISAGMPMOVW-SOURCELEDGER table field - Source Ledger
▼
Description: Source Ledger Field Name: SOURCELEDGER Data Element: FINS_LEDGER_PERS Data Type: CHAR length (Dec): 2(0) Check table: FINSC_LEDGER Conversion Routine: ALPHA Domain Name: FINS_LEDGER MemoryID: GLN_FLEX AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field SOURCELEDGER
|
ISAGMPMOVW-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: FIS_BUKRS Data Type: CHAR length (Dec): 4(0) Check table: T001 Conversion Routine: Domain Name: BUKRS MemoryID: BUK AppClass: FB SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
ISAGMPMOVW-FISCALYEAR table field - Fiscal Year
▼
Description: Fiscal Year Field Name: FISCALYEAR Data Element: FIS_GJAHR Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: GJAHR Domain Name: GJAHR MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: GJAHR See all SAP tables containing field FISCALYEAR
|
ISAGMPMOVW-ACCOUNTINGDOCUMENT table field - Journal Entry
▼
Description: Journal Entry Field Name: ACCOUNTINGDOCUMENT Data Element: FIS_BELNR Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: BELNR MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field ACCOUNTINGDOCUMENT
|
ISAGMPMOVW-LEDGERGLLINEITEM table field - Ledger Journal Entry Item
▼
Description: Ledger Journal Entry Item Field Name: LEDGERGLLINEITEM Data Element: FIS_DOCLN Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: DOCLN6 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LEDGERGLLINEITEM
|
ISAGMPMOVW-FINANCIALPLANNINGREQTRANSSQNC table field - Financial Planning Request Transaction Sequence Number
▼
Description: Financial Planning Request Transaction Sequence Number Field Name: FINANCIALPLANNINGREQTRANSSQNC Data Element: FIS_FP_REQUEST_TSN Data Type: NUMC length (Dec): 23(0) Check table: Conversion Routine: Domain Name: FIS_RSPM_TSN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FINANCIALPLANNINGREQTRANSSQNC
|
ISAGMPMOVW-FINANCIALPLANNINGDATAPACKET table field - Financial Planning Data Packet Number
▼
Description: Financial Planning Data Packet Number Field Name: FINANCIALPLANNINGDATAPACKET Data Element: FIS_FP_DATA_PACKET Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: NUM6 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field FINANCIALPLANNINGDATAPACKET
|
ISAGMPMOVW-FINANCIALPLANNINGENTRYITEM table field - Financial Planning Entry Item
▼
Description: Financial Planning Entry Item Field Name: FINANCIALPLANNINGENTRYITEM Data Element: FIS_FP_ENTRY_ITEM_NEW Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: FIS_UH_UNSIGN_INT4 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FINANCIALPLANNINGENTRYITEM
|
ISAGMPMOVW-GLACCOUNTHIERARCHY table field - Financial Statement Version
▼
Description: Financial Statement Version Field Name: GLACCOUNTHIERARCHY Data Element: FINS_SEM_TAG_HRYID Data Type: CHAR length (Dec): 42(0) Check table: Conversion Routine: Domain Name: DHRYID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GLACCOUNTHIERARCHY
|
ISAGMPMOVW-SEMANTICTAG table field - Semantic Tag of a Hierarchy Node
▼
Description: Semantic Tag of a Hierarchy Node Field Name: SEMANTICTAG Data Element: FINS_SEM_TAG Data Type: CHAR length (Dec): 10(0) Check table: FINSC_SEM_TAG Conversion Routine: Domain Name: FINS_SEM_TAG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SEMANTICTAG
|
ISAGMPMOVW-FISCALPERIOD table field - Fiscal Period
▼
Description: Fiscal Period Field Name: FISCALPERIOD Data Element: FINS_FISCALPERIOD Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: POPER MemoryID: POPR AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field FISCALPERIOD
|
ISAGMPMOVW-PLANNINGCATEGORY table field - Plan Category
▼
Description: Plan Category Field Name: PLANNINGCATEGORY Data Element: FCOM_CATEGORY Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: FCOM_CATEGORY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field PLANNINGCATEGORY
|
ISAGMPMOVW-BASEUNIT table field - Base Unit of Measure
▼
Description: Base Unit of Measure Field Name: BASEUNIT Data Element: MEINS Data Type: UNIT length (Dec): 3(0) Check table: T006 Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field BASEUNIT
|
ISAGMPMOVW-BASEUNITNAME table field - Unit of Measurement Text (Maximum 10 Characters)
▼
Description: Unit of Measurement Text (Maximum 10 Characters) Field Name: BASEUNITNAME Data Element: MSEHT Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: TEXT10 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASEUNITNAME
|
ISAGMPMOVW-LEDGERNAME table field - Ledger Name
▼
Description: Ledger Name Field Name: LEDGERNAME Data Element: LDTXT Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: TEXT30 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field LEDGERNAME
|
ISAGMPMOVW-COMPANYCODENAME table field - Name of Company Code or Company
▼
Description: Name of Company Code or Company Field Name: COMPANYCODENAME Data Element: BUTXT Data Type: CHAR length (Dec): 25(0) Check table: Conversion Routine: Domain Name: TEXT25 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMPANYCODENAME
|
ISAGMPMOVW-COMPANYCODECURRENCY table field - Company Code Currency
▼
Description: Company Code Currency Field Name: COMPANYCODECURRENCY Data Element: FIS_HWAER Data Type: CUKY length (Dec): 5(0) Check table: TCURC Conversion Routine: Domain Name: WAERS MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMPANYCODECURRENCY
|
ISAGMPMOVW-COUNTRY table field - Country/Region Key
▼
Description: Country/Region Key Field Name: COUNTRY Data Element: LAND1 Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: LAND1 MemoryID: LND AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field COUNTRY
|
ISAGMPMOVW-COUNTRYNAME table field - Country/Region Name
▼
Description: Country/Region Name Field Name: COUNTRYNAME Data Element: LANDX50 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: TEXT50 MemoryID: AppClass: SLG SHLP: SHLP Field: ConvExit: See all SAP tables containing field COUNTRYNAME
|
ISAGMPMOVW-SALESORGANIZATION table field - Sales Organization
▼
Description: Sales Organization Field Name: SALESORGANIZATION Data Element: VKORG Data Type: CHAR length (Dec): 4(0) Check table: TVKO Conversion Routine: Domain Name: VKORG MemoryID: VKO AppClass: MG SHLP: C_VKORG SHLP Field: VKORG ConvExit: See all SAP tables containing field SALESORGANIZATION
|
ISAGMPMOVW-SALESORGANIZATIONNAME table field - Sales Organization Description
▼
Description: Sales Organization Description Field Name: SALESORGANIZATIONNAME Data Element: SALESORGANIZATIONNAME Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: TEXT20 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESORGANIZATIONNAME
|
ISAGMPMOVW-DIVISION table field - Division
▼
Description: Division Field Name: DIVISION Data Element: SPART Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: SPART MemoryID: SPA AppClass: V SHLP: C_SPART SHLP Field: SPART ConvExit: See all SAP tables containing field DIVISION
|
ISAGMPMOVW-DIVISIONNAME table field - Division Description
▼
Description: Division Description Field Name: DIVISIONNAME Data Element: DIVISIONNAME Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: TEXT20 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field DIVISIONNAME
|
ISAGMPMOVW-DISTRIBUTIONCHANNEL table field - Distribution Channel
▼
Description: Distribution Channel Field Name: DISTRIBUTIONCHANNEL Data Element: VTWEG Data Type: CHAR length (Dec): 2(0) Check table: TVTW Conversion Routine: Domain Name: VTWEG MemoryID: VTW AppClass: MG SHLP: C_VTWEG SHLP Field: VTWEG ConvExit: See all SAP tables containing field DISTRIBUTIONCHANNEL
|
ISAGMPMOVW-DISTRIBUTIONCHANNELNAME table field - Distribution Channel Description
▼
Description: Distribution Channel Description Field Name: DISTRIBUTIONCHANNELNAME Data Element: DISTRIBUTIONCHANNELNAME Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: TEXT20 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field DISTRIBUTIONCHANNELNAME
|
ISAGMPMOVW-CUSTOMER table field - Customer Number
▼
Description: Customer Number Field Name: CUSTOMER Data Element: KUNNR Data Type: CHAR length (Dec): 10(0) Check table: KNA1 Conversion Routine: ALPHA Domain Name: KUNNR MemoryID: KUN AppClass: V SHLP: C_KUNNR SHLP Field: KUNNR ConvExit: ALPHA See all SAP tables containing field CUSTOMER
|
ISAGMPMOVW-CUSTOMERNAME table field - Name of Customer
▼
Description: Name of Customer Field Name: CUSTOMERNAME Data Element: MD_CUSTOMER_NAME Data Type: CHAR length (Dec): 80(0) Check table: Conversion Routine: Domain Name: TEXT80 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field CUSTOMERNAME
|
ISAGMPMOVW-MATERIAL table field - Sold Material
▼
Description: Sold Material Field Name: MATERIAL Data Element: FIS_SOLD_MATERIAL Data Type: CHAR length (Dec): 40(0) Check table: MARA Conversion Routine: MATN1 Domain Name: MATNR MemoryID: MAT AppClass: MG SHLP: SHLP Field: ConvExit: MATN1 See all SAP tables containing field MATERIAL
|
ISAGMPMOVW-MATERIALNAME table field - Material Description
▼
Description: Material Description Field Name: MATERIALNAME Data Element: MAKTX Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: TEXT40 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALNAME
|
ISAGMPMOVW-MATERIALGROUP table field - Product Sold Group
▼
Description: Product Sold Group Field Name: MATERIALGROUP Data Element: FINS_MATKL_PA Data Type: CHAR length (Dec): 9(0) Check table: T023 Conversion Routine: Domain Name: MATKL MemoryID: MKL AppClass: MG SHLP: S_WBWG SHLP Field: MATKL ConvExit: See all SAP tables containing field MATERIALGROUP
|
ISAGMPMOVW-MATERIALGROUPNAME table field - Product Group Description
▼
Description: Product Group Description Field Name: MATERIALGROUPNAME Data Element: PRODUCTGROUPDESCRIPTION Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: TEXT20 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALGROUPNAME
|
ISAGMPMOVW-CUSTOMERGROUP table field - Customer Group
▼
Description: Customer Group Field Name: CUSTOMERGROUP Data Element: KDGRP Data Type: CHAR length (Dec): 2(0) Check table: T151 Conversion Routine: Domain Name: KDGRP MemoryID: VKD AppClass: V SHLP: SHLP Field: ConvExit: See all SAP tables containing field CUSTOMERGROUP
|
ISAGMPMOVW-GLACCOUNT table field - G/L Account
▼
Description: G/L Account Field Name: GLACCOUNT Data Element: FIS_RACCT Data Type: CHAR length (Dec): 10(0) Check table: SKB1 Conversion Routine: ALPHA Domain Name: SAKNR MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field GLACCOUNT
|
ISAGMPMOVW-PROFITCENTER table field - Profit Center
▼
Description: Profit Center Field Name: PROFITCENTER Data Element: FIS_PRCTR Data Type: CHAR length (Dec): 10(0) Check table: CEPC Conversion Routine: ALPHA Domain Name: PRCTR MemoryID: PRC AppClass: KE SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field PROFITCENTER
|
ISAGMPMOVW-CUSTOMERSUPPLIERCOUNTRY table field - Customer or Supplier Country/Region
▼
Description: Customer or Supplier Country/Region Field Name: CUSTOMERSUPPLIERCOUNTRY Data Element: FIS_LAND1_GP Data Type: CHAR length (Dec): 3(0) Check table: T005 Conversion Routine: Domain Name: LAND1 MemoryID: AppClass: SAP SHLP: C_LAND1 SHLP Field: LAND1 ConvExit: See all SAP tables containing field CUSTOMERSUPPLIERCOUNTRY
|
ISAGMPMOVW-CUSTOMERSUPPLIERINDUSTRY table field - Customer Supplier Industry
▼
Description: Customer Supplier Industry Field Name: CUSTOMERSUPPLIERINDUSTRY Data Element: FIS_BRSCH Data Type: CHAR length (Dec): 4(0) Check table: T016 Conversion Routine: Domain Name: BRSCH MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field CUSTOMERSUPPLIERINDUSTRY
|
ISAGMPMOVW-RATIOUNIT table field - Unit of Measurement
▼
Description: Unit of Measurement Field Name: RATIOUNIT Data Element: MSEHI Data Type: UNIT length (Dec): 3(0) Check table: Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field RATIOUNIT
|
ISAGMPMOVW-GLOBALCURRENCY table field - Global Currency
▼
Description: Global Currency Field Name: GLOBALCURRENCY Data Element: FIS_RKCUR Data Type: CUKY length (Dec): 5(0) Check table: TCURC Conversion Routine: Domain Name: WAERS MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field GLOBALCURRENCY
|
ISAGMPMOVW-INTVL1GROSSPROFITAMTINGLOBCRCY table field - Amount in Global Currency
▼
Description: Amount in Global Currency Field Name: INTVL1GROSSPROFITAMTINGLOBCRCY Data Element: FIS_KSL Data Type: CURR length (Dec): 23(2) Check table: Conversion Routine: Domain Name: WERTV12 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INTVL1GROSSPROFITAMTINGLOBCRCY
|
ISAGMPMOVW-INTVL1RECGDREVNAMTINGLOBCRCY table field - Amount in Global Currency
▼
Description: Amount in Global Currency Field Name: INTVL1RECGDREVNAMTINGLOBCRCY Data Element: FIS_KSL Data Type: CURR length (Dec): 23(2) Check table: Conversion Routine: Domain Name: WERTV12 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INTVL1RECGDREVNAMTINGLOBCRCY
|
ISAGMPMOVW-INTVL2GROSSPROFITAMTINGLOBCRCY table field - Amount in Global Currency
▼
Description: Amount in Global Currency Field Name: INTVL2GROSSPROFITAMTINGLOBCRCY Data Element: FIS_KSL Data Type: CURR length (Dec): 23(2) Check table: Conversion Routine: Domain Name: WERTV12 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INTVL2GROSSPROFITAMTINGLOBCRCY
|
ISAGMPMOVW-INTVL2RECGDREVNAMTINGLOBCRCY table field - Amount in Global Currency
▼
Description: Amount in Global Currency Field Name: INTVL2RECGDREVNAMTINGLOBCRCY Data Element: FIS_KSL Data Type: CURR length (Dec): 23(2) Check table: Conversion Routine: Domain Name: WERTV12 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INTVL2RECGDREVNAMTINGLOBCRCY
|
ISAGMPMOVW-FINANCIALACCOUNTTYPE table field - Account Type
▼
Description: Account Type Field Name: FINANCIALACCOUNTTYPE Data Element: FARP_KOART Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FARP_KOART MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field FINANCIALACCOUNTTYPE
|
ISAGMPMOVW-BUSINESSAREA table field - Business Area
▼
Description: Business Area Field Name: BUSINESSAREA Data Element: FIS_RBUSA Data Type: CHAR length (Dec): 4(0) Check table: TGSB Conversion Routine: Domain Name: GSBER MemoryID: GSB AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUSINESSAREA
|
ISAGMPMOVW-SEGMENT table field - Segment for Segmental Reporting
▼
Description: Segment for Segmental Reporting Field Name: SEGMENT Data Element: FB_SEGMENT Data Type: CHAR length (Dec): 10(0) Check table: FAGL_SEGM Conversion Routine: ALPHA Domain Name: FB_SEGMENT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field SEGMENT
|
ISAGMPMOVW-CONTROLLINGAREA table field - Controlling Area
▼
Description: Controlling Area Field Name: CONTROLLINGAREA Data Element: FIS_KOKRS Data Type: CHAR length (Dec): 4(0) Check table: TKA01 Conversion Routine: Domain Name: CACCD MemoryID: CAC AppClass: KS SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLINGAREA
|
ISAGMPMOVW-COSTCENTER table field - Cost Center
▼
Description: Cost Center Field Name: COSTCENTER Data Element: FIS_KOSTL Data Type: CHAR length (Dec): 10(0) Check table: CSKS Conversion Routine: ALPHA Domain Name: KOSTL MemoryID: KOS AppClass: KA SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field COSTCENTER
|
ISAGMPMOVW-PLANT table field - Plant
▼
Description: Plant Field Name: PLANT Data Element: WERKS_D Data Type: CHAR length (Dec): 4(0) Check table: T001W Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field PLANT
|
ISAGMPMOVW-VALUATIONAREA table field - Valuation area
▼
Description: Valuation area Field Name: VALUATIONAREA Data Element: BWKEY Data Type: CHAR length (Dec): 4(0) Check table: T001K Conversion Routine: Domain Name: BWKEY MemoryID: BWK AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field VALUATIONAREA
|
ISAGMPMOVW-ORGANIZATIONDIVISION table field - Division
▼
Description: Division Field Name: ORGANIZATIONDIVISION Data Element: SPART Data Type: CHAR length (Dec): 2(0) Check table: TSPA Conversion Routine: Domain Name: SPART MemoryID: SPA AppClass: V SHLP: C_SPART SHLP Field: SPART ConvExit: See all SAP tables containing field ORGANIZATIONDIVISION
|
ISAGMPMOVW-SERVICEDOCUMENTTYPE table field - Service Document Type
▼
Description: Service Document Type Field Name: SERVICEDOCUMENTTYPE Data Element: FCO_SRVDOC_TYPE Data Type: CHAR length (Dec): 4(0) Check table: CRMC_PROC_TYPE Conversion Routine: Domain Name: CRM_PROCESS_TYPE MemoryID: SVDT_FCO AppClass: SHLP: FCO_SHLP_SRVDOC_TYPE_EMPTY SHLP Field: SERVICEDOCUMENTTYPE ConvExit: See all SAP tables containing field SERVICEDOCUMENTTYPE
|
ISAGMPMOVW-ASSETCLASS table field - Asset Class
▼
Description: Asset Class Field Name: ASSETCLASS Data Element: ANLKL Data Type: CHAR length (Dec): 8(0) Check table: ANKA Conversion Routine: ALPHA Domain Name: ANLKL MemoryID: ANK AppClass: AA SHLP: SH_ANLKA SHLP Field: ANLKL ConvExit: ALPHA See all SAP tables containing field ASSETCLASS
|
ISAGMPMOVW-POSTINGDATE table field - Posting Date
▼
Description: Posting Date Field Name: POSTINGDATE Data Element: FIS_BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field POSTINGDATE
|
ISAGMPMOVW-SUPPLIER table field - Supplier
▼
Description: Supplier Field Name: SUPPLIER Data Element: MD_SUPPLIER Data Type: CHAR length (Dec): 10(0) Check table: LFA1 Conversion Routine: ALPHA Domain Name: LIFNR MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field SUPPLIER
|
ISAGMPMOVW-SALESDOCUMENT table field - Sales Document
▼
Description: Sales Document Field Name: SALESDOCUMENT Data Element: VBELN_VA Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: VBELN MemoryID: AUN AppClass: V SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field SALESDOCUMENT
|
ISAGMPMOVW-ORDERID table field - Order ID
▼
Description: Order ID Field Name: ORDERID Data Element: FIS_AUFNR Data Type: CHAR length (Dec): 12(0) Check table: AUFK Conversion Routine: ALPHA Domain Name: AUFNR MemoryID: ANR AppClass: SAP SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field ORDERID
|
ISAGMPMOVW-ACCOUNTINGDOCUMENTTYPE table field - Journal Entry Type
▼
Description: Journal Entry Type Field Name: ACCOUNTINGDOCUMENTTYPE Data Element: FIS_BLART Data Type: CHAR length (Dec): 2(0) Check table: T003 Conversion Routine: Domain Name: BLART MemoryID: BAR AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACCOUNTINGDOCUMENTTYPE
|
ISAGMPMOVW-SERVICEDOCUMENT table field - Service Document ID
▼
Description: Service Document ID Field Name: SERVICEDOCUMENT Data Element: FCO_SRVDOC_ID Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: CRM_OBJECT_ID MemoryID: SVD_FCO AppClass: SHLP: FCO_SHLP_SRVDOC_EMPTY SHLP Field: SERVICEDOCUMENT ConvExit: ALPHA See all SAP tables containing field SERVICEDOCUMENT
|