Details |
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAINVDOCREV-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINVDOCREV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAINVMDCAT_CI-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINVMDCAT_CI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICABIPRINVDOC_H-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABIPRINVDOC_H table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAINVMDCAT_CIT-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINVMDCAT_CIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCA_BIP_H-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCA_BIP_H table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICA_BIP_H-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICA_BIP_H table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAINV_CFC-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINV_CFC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAINV_CFC-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINV_CFC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAINVDOC_H-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINVDOC_H table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAINV_TRIG-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINV_TRIG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICABIPRBIPH-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABIPRBIPH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAINVCFCTP-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINVCFCTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAINVDOC_H-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINVDOC_H table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAINV_TRIG-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINV_TRIG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICA_BIP_HTP-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICA_BIP_HTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAINVBILL_H-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINVBILL_H table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAINVDOCREV-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINVDOCREV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCA_BIP_H_VH-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCA_BIP_H_VH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAINVBILL_H-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINVBILL_H table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAINVDOC_H2-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINVDOC_H2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCABILLDOCREV-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCABILLDOCREV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAINVDOCMC_H-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINVDOCMC_H table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFKKINV_CFC_D-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKINV_CFC_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_CA_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_CA_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKINVDOC_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINVDOC_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKINV_CA_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_CA_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICABILLDOCREV-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABILLDOCREV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAINVDOCMC_H-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINVDOCMC_H table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAINVDOCH_COH-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINVDOCH_COH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAINVDOC_DISP-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINVDOC_DISP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAINVOVWDOC_H-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINVOVWDOC_H table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKINVBILL_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINVBILL_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCABILLGPLNTP-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCABILLGPLNTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAINVBILL_DISP-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINVBILL_DISP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAINVOVWBILL_H-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINVOVWBILL_H table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAINVOVWBLLPLN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINVOVWBLLPLN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFKKBIX_BIP_H_D-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKBIX_BIP_H_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKINVDOC_H_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINVDOC_H_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKINV_TRIG_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_TRIG_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_BIP_H_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_BIP_H_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKINVBILL_H_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINVBILL_H_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKK_VT_BIP_H_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_VT_BIP_H_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICABIPRBILLDOC_H-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABIPRBILLDOC_H table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCABILLGPLNTP_D-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCABILLGPLNTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CINV_FDP_INVDOC_H-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINV_FDP_INVDOC_H table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCABILLGPLNTP_DR-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCABILLGPLNTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CINV_FDP_INVBILL_H-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINV_FDP_INVBILL_H table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_UNIT_MD_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_UNIT_MD_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKINV_UNIT_MD_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_UNIT_MD_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_BILLPLAN_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_BILLPLAN_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIXBIT_IT_ALL_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXBIT_IT_ALL_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKINVDOC_H_DATA_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINVDOC_H_DATA_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKINV_TRIG_DATA_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_TRIG_DATA_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIXBIT0_IT_ALL_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXBIT0_IT_ALL_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIXBIT2_IT_ALL_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXBIT2_IT_ALL_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIXBIT4_IT_ALL_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXBIT4_IT_ALL_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_BIP_H_DATA_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_BIP_H_DATA_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKINVBILL_H_DATA_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINVBILL_H_DATA_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_BILLITEM_IT_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_BILLITEM_IT_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKINV_SRCDOC_DATA_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_SRCDOC_DATA_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCAINVCGCLRFCTNCASETP-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAINVCGCLRFCTNCASETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKINV_SRCDOC_INVBI_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_SRCDOC_INVBI_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKINV_SRCDOC_PRLIN_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_SRCDOC_PRLIN_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIXBIT_API_IT_ALL_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXBIT_API_IT_ALL_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_ICBIT0_IT_ALL_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_ICBIT0_IT_ALL_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_ICBIT2_IT_ALL_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_ICBIT2_IT_ALL_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_ICBIT4_IT_ALL_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_ICBIT4_IT_ALL_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCAINVCGCLRFCTNCASETP_D-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAINVCGCLRFCTNCASETP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_BU_BILLITEM_IT_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_BU_BILLITEM_IT_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCAINVCGCLRFCTNCASETP_DR-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAINVCGCLRFCTNCASETP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_ICBIT_API_IT_ALL_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_ICBIT_API_IT_ALL_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_UNIT_PUBLIC_DATA_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_UNIT_PUBLIC_DATA_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_UNIT_PUBLIC_DATA_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_UNIT_PUBLIC_DATA_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKINV_UNIT_PUBLIC_DATA_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_UNIT_PUBLIC_DATA_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKINV_UNIT_PUBLIC_DATA_GFN-CAINVCGMASTERDATATYPE table field - Type of Master Data for Billing and Invoicing
▼
Description: Type of Master Data for Billing and Invoicing Field Name: CAINVCGMASTERDATATYPE Data Element: MDCAT_CI_KK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MDCAT_CI_KK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_UNIT_PUBLIC_DATA_GFN table
|