Details |
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBOMITEMS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBOMITEMS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPHYINVGR-ISDELETED table field - Deletion indicator
▼
Description: Deletion indicator Field Name: ISDELETED Data Element: OII_DELIND Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPHYINVGR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOITEMTP-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 15(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOITEMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPHYINVGR-ISDELETED table field - Deletion indicator
▼
Description: Deletion indicator Field Name: ISDELETED Data Element: OII_DELIND Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPHYINVGR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
APURREQACC-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURREQACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
APURREQITM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURREQITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBOMITEMTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBOMITEMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNOTIFITTP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNOTIFITTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPIRSTRUCT-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPIRSTRUCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBOMITEMWD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOMITEMWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICHARCTEXT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICHARCTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICHARVALUE-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICHARVALUE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTTLOP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTTLOP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMTMERECG-ISDELETED table field - Indicator: Document was reversed
▼
Description: Indicator: Document was reversed Field Name: ISDELETED Data Element: CO_STOKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FLAG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMTMERECG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRSSPITEM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRSSPITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOMAINTITM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMAINTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRITEMMNTR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRITEMMNTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURREQNITM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQNITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CQLTYTSKMNG-ISDELETED table field - Quality Tasks Flagged for Deletion
▼
Description: Quality Tasks Flagged for Deletion Field Name: ISDELETED Data Element: VDM_QM_QUALITYTASKDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYTSKMNG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSLCQNREVAL-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLCQNREVAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPERSNCODE-ISDELETED table field - Data Record Was Deleted
▼
Description: Data Record Was Deleted Field Name: ISDELETED Data Element: QGEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPERSNCODE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISESTMERECG-ISDELETED table field - Indicator: Document was reversed
▼
Description: Indicator: Document was reversed Field Name: ISDELETED Data Element: CO_STOKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FLAG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISESTMERECG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PBOMITEMSWD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PBOMITEMSWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
P_SCME_RG_V-ISDELETED table field - Data element for domain BOOLE: TRUE (='X') and FALSE (=' ')
▼
Description: Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') Field Name: ISDELETED Data Element: BOOLE_D Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP P_SCME_RG_V table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CEPWRKPCKGRQ-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEPWRKPCKGRQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CIRMNGALLTXT-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CIRMNGALLTXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CIRMNGSOSOVW-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CIRMNGSOSOVW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMPEMFGARCTP-ISDELETED table field - Data Record Was Deleted
▼
Description: Data Record Was Deleted Field Name: ISDELETED Data Element: QGEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPEMFGARCTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPMNOTIFHEAD-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPMNOTIFHEAD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOACCTASSTP-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOACCTASSTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRCHINFOREC-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRCHINFOREC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
C_MM_PR_LIST-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP C_MM_PR_LIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IARMMATLINSP-ISDELETED table field - Inspection Outcome: Delete flag
▼
Description: Inspection Outcome: Delete flag Field Name: ISDELETED Data Element: /SPE/LSKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: /SPE/LSKENZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IARMMATLINSP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IEPWRKPCKGRQ-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEPWRKPCKGRQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IINSPOPCHVRS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPOPCHVRS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPEMFGARCTP-ISDELETED table field - Data Record Was Deleted
▼
Description: Data Record Was Deleted Field Name: ISDELETED Data Element: QGEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPEMFGARCTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPOACCTASSTP-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPOACCTASSTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRVCENTRSHT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVCENTRSHT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPIRPOPRHIST-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPIRPOPRHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
P_COMPONENTS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP P_COMPONENTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CIPMATLASSGMT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CIPMATLASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMEMORECORDTP-ISDELETED table field - Deleted
▼
Description: Deleted Field Name: ISDELETED Data Element: FQM_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FQM_DELETED MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMEMORECORDTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMFGORDDEFREC-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMFGORDDEFREC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMLSTNBSCINFO-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: PS_S4_LOEVM Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMLSTNBSCINFO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMNTNTFROOTIT-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMNTNTFROOTIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOACCTASSNTP-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOACCTASSNTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRACCTASSGMT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRACCTASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURGINFRECFS-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURGINFRECFS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSUPEVTEMPMAN-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPEVTEMPMAN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICHGIMPBOMITM-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICHGIMPBOMITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTORDCOMP-ISDELETED table field - Item is deleted
▼
Description: Item is deleted Field Name: ISDELETED Data Element: XLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTORDCOMP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMEMORECORDTP-ISDELETED table field - Deleted
▼
Description: Deleted Field Name: ISDELETED Data Element: FQM_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FQM_DELETED MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMEMORECORDTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMTORDOPRCOMP-ISDELETED table field - Item is deleted
▼
Description: Item is deleted Field Name: ISDELETED Data Element: XLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMTORDOPRCOMP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURREQNITMWD-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNITMWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IWFLWTEMPLATE-ISDELETED table field - Logical Deletion Flag
▼
Description: Logical Deletion Flag Field Name: ISDELETED Data Element: SWF_FLEX_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWFLWTEMPLATE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NPRACCTASSGMT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NPRACCTASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPRSSPITEMEXT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRSSPITEMEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
P_SCRL_LBRG_V-ISDELETED table field - Data element for domain BOOLE: TRUE (='X') and FALSE (=' ')
▼
Description: Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') Field Name: ISDELETED Data Element: BOOLE_D Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP P_SCRL_LBRG_V table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCNTXIBNDGRECD-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTXIBNDGRECD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDOCLPRDETAILS-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDOCLPRDETAILS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CINSPPLOPCHARC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPPLOPCHARC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMILESTONEVERS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: PS_S4_LOEVM Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMILESTONEVERS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOMAINTREFDOC-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMAINTREFDOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURINFRECHIST-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURINFRECHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSRVCENTRSHTWD-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVCENTRSHTWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICABOOOPBOMICS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABOOOPBOMICS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICHARVALUETEXT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICHARVALUETEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IEPREVDATACUBE-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEPREVDATACUBE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IEPWRKPPLNACTC-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEPWRKPPLNACTC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTOPCOMPTP-ISDELETED table field - Item is deleted
▼
Description: Item is deleted Field Name: ISDELETED Data Element: XLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTOPCOMPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTTASKLIST-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTTASKLIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTTLOPMATL-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTTLOPMATL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMILESTONEVERS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMILESTONEVERS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFITEMDATA-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFITEMDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IOBJDEPENDENCY-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IOBJDEPENDENCY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPMORDOPERDATA-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPMORDOPERDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROJMILESTONE-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: PS_S4_LOEVM Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJMILESTONE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURREQNITEMWD-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNITEMWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRVCENTRSHTTP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVCENTRSHTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NMAINTTASKLIST-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NMAINTTASKLIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMAINTTASKLIST-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMAINTTASKLIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMILESTONEVERS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMILESTONEVERS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOMAINTITMACT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOMAINTITMACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURCTRACCNTWD-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURCTRACCNTWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURINFRECHIST-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURINFRECHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURINFRECMASS-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURINFRECMASS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PVALIDVERSNBOM-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PVALIDVERSNBOM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
S_V_SCRL_REG_C-ISDELETED table field - Data element for domain BOOLE: TRUE (='X') and FALSE (=' ')
▼
Description: Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') Field Name: ISDELETED Data Element: BOOLE_D Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP S_V_SCRL_REG_C table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURINFRECDPOPH-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURINFRECDPOPH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURORDREFDOCIR-ISDELETED table field - Purch. info: Purch. organization data flagged for deletion
▼
Description: Purch. info: Purch. organization data flagged for deletion Field Name: ISDELETED Data Element: ILOEE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDREFDOCIR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURORDREFDOCPC-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDREFDOCPC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURORDSUPLCONF-ISDELETED table field - Supplier Confirmation Deletion Indicator
▼
Description: Supplier Confirmation Deletion Indicator Field Name: ISDELETED Data Element: BBLOE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDSUPLCONF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURREQITEMMNTR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQITEMMNTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
C_MM_PRLIST_EXT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP C_MM_PRLIST_EXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTXIBINDGRECD-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTXIBINDGRECD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IICLOBJASSIGNMT-ISDELETED table field - Database Line Status (Original, Changed, Deleted)
▼
Description: Database Line Status (Original, Changed, Deleted) Field Name: ISDELETED Data Element: ICL_RECSTATUS Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ICL_RECSTATUS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IICLOBJASSIGNMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMEMOWITHFILTER-ISDELETED table field - Deleted
▼
Description: Deleted Field Name: ISDELETED Data Element: FQM_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FQM_DELETED MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMEMOWITHFILTER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGWIVERSIONTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGWIVERSIONTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPMTASKLISTDATA-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPMTASKLISTDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYINPROCMTTP-ISDELETED table field - Deletion Flag
▼
Description: Deletion Flag Field Name: ISDELETED Data Element: QLOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYINPROCMTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISESITMOAPOCRCY-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISESITMOAPOCRCY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRVCENTRSHTITM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVCENTRSHTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IWIPRRQHDITMDET-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWIPRRQHDITMDET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPDACCTASSGMTWD-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPDACCTASSGMTWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOMAINTITEMALL-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOMAINTITEMALL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PTSKLSTMNTPCKGS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PTSKLSTMNTPCKGS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
P_VALIDBOMITEMS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP P_VALIDBOMITEMS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCNTRLPCONDSTRTP-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTRLPCONDSTRTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCNTXIBNDGRECDDR-ISDELETED table field - China Tax Invoice Binding Deleted
▼
Description: China Tax Invoice Binding Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_BND_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTXIBNDGRECDDR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIINTORDERQ0001-ISDELETED table field - Deletion Flag
▼
Description: Deletion Flag Field Name: ISDELETED Data Element: AUFLOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIINTORDERQ0001 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMPUREVALUSRCRI-ISDELETED table field - Indicates if the field can be deleted or not
▼
Description: Indicates if the field can be deleted or not Field Name: ISDELETED Data Element: MMPUR_ANA_USRCRT_DELETE_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_USRCRT_DELETE_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPUREVALUSRCRI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMRPMAINTORDCOMP-ISDELETED table field - Item is deleted
▼
Description: Item is deleted Field Name: ISDELETED Data Element: XLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMRPMAINTORDCOMP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOMAINTREFDOCVH-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMAINTREFDOCVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURCTRACTASSIGN-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURCTRACTASSIGN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSRVCENTRSH000WD-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVCENTRSH000WD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSRVCENTRSH001WD-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVCENTRSH001WD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBOMCOMPWITHDATE-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOMCOMPWITHDATE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTRLPCHDRDISTR-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLPCHDRDISTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTRLPCONDSTRTP-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLPCONDSTRTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IINSPPLOPCHARCTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPPLOPCHARCTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ILOCANALYSISCUBE-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILOCANALYSISCUBE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTTLOPTECOBJ-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTTLOPTECOBJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMEMOMSTRDATASIG-ISDELETED table field - Deleted
▼
Description: Deleted Field Name: ISDELETED Data Element: FQM_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FQM_DELETED MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMEMOMSTRDATASIG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPMTSKLISTOPDATA-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPMTSKLISTOPDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQINFRCDINPROCUN-ISDELETED table field - Deletion Flag
▼
Description: Deletion Flag Field Name: ISDELETED Data Element: QLOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQINFRCDINPROCUN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYINFORECPROC-ISDELETED table field - Deletion Flag
▼
Description: Deletion Flag Field Name: ISDELETED Data Element: QLOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYINFORECPROC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISESITMTOTCONFAM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISESITMTOTCONFAM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISESITMTOTCONFDQ-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISESITMTOTCONFDQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRVCENTRSH000TP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVCENTRSH000TP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRVCENTRSH001TP-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVCENTRSH001TP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRVCENTRSHTACCT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVCENTRSHTACCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOMAINTITMDRAFT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOMAINTITMDRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOMAINTREFDOCAL-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOMAINTREFDOCAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPRCHINFORECORDS-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRCHINFORECORDS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CIPPRT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CIPPRT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPIVMR-ISDELETED table field - Deletion indicator
▼
Description: Deletion indicator Field Name: ISDELETED Data Element: OII_DELIND Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPIVMR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IVCHOD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVCHOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ADEFECT-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ADEFECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDEFREC-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFREC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDEFECT-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDEFECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRITEM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRTGACT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRTGHDR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGHDR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRTGOPR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGOPR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMNTOBD-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMNTOBD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
P_ITEMS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP P_ITEMS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
QTASK_D-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QTASK_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IINSPPLV-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPPLV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IIPOPPRT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IIPOPPRT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IIPPRTTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IIPPRTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INGCCHR1-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INGCCHR1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYTSK-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYTSK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRCSLTP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRCSLTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MPE_WI_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPE_WI_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
QIPPRT_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QIPPRT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ABOMITEMS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ABOMITEMS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CINSPPLOP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPPLOP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CINSPPLTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPPLTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSUPLRLTP-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPLRLTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBOMCOMPS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOMCOMPS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBOMITEMS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOMITEMS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTXIIPT-ISDELETED table field - China Tax Invoice Deleted
▼
Description: China Tax Invoice Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTXIIPT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDEFECTTP-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDEFECTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IIBINSTHR-ISDELETED table field - Yes/No (X/ )
▼
Description: Yes/No (X/ ) Field Name: ISDELETED Data Element: OAX Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: X MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IIBINSTHR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IINSPPLTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPPLTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IIPMATLTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IIPMATLTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IKBOMITEM-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IKBOMITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INGCCHR17-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INGCCHR17 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INGCCHR18-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INGCCHR18 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INGCCHR19-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INGCCHR19 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INGCCHR20-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INGCCHR20 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INGCCLFN9-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INGCCLFN9 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INGCCLS12-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INGCCLS12 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFACT-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFITM-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFPAR-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFPAR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFTSK-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFTSK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRCSLIST-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRCSLIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUPLRLTP-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPLRLTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IVCHODBSC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVCHODBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IVCHODTXT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVCHODTXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IWKCGPAOR-ISDELETED table field - Checkbox
▼
Description: Checkbox Field Name: ISDELETED Data Element: XFELD Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWKCGPAOR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSRCSL_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCSL_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCNTXIIPT-ISDELETED table field - China Tax Invoice Deleted
▼
Description: China Tax Invoice Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCNTXIIPT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PNGCCHR13-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNGCCHR13 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
QDEFECT_D-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QDEFECT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
QINSPPL_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINSPPL_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
QIPMATL_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QIPMATL_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
APURINFREC-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURINFREC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDEFECTFDP-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFECTFDP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDEFECTMNG-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFECTMNG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDEFTSKREC-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFTSKREC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CEXTPRITEM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEXTPRITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMFGORDDEF-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMFGORDDEF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
COPTECHOBJ-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COPTECHOBJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EKPO_DISTR-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EKPO_DISTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBOMITEMTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOMITEMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBOORELSHP-ISDELETED table field - Asset class marked for deletion
▼
Description: Asset class marked for deletion Field Name: ISDELETED Data Element: LOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOORELSHP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICFINPOACC-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFINPOACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDEFECTUNI-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDEFECTUNI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IIPLNOPVRS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IIPLNOPVRS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INGCCLFN11-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INGCCLFN11 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INGCCLFN12-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INGCCLFN12 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INGCCLFN23-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INGCCLFN23 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INGCCLFN24-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INGCCLFN24 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPOCONFAPI-ISDELETED table field - Supplier Confirmation Deletion Indicator
▼
Description: Supplier Confirmation Deletion Indicator Field Name: ISDELETED Data Element: BBLOE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPOCONFAPI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURINFREC-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURINFREC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYNOTIF-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNOTIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYTSKTP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYTSKTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQNOTIFACT-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQNOTIFACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQNOTIFPAR-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQNOTIFPAR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQNOTIFTSK-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQNOTIFTSK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRTGSUBOPR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGSUBOPR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRCSLBUPA-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRCSLBUPA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUPLRLIST-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPLRLIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IVCODSRCCD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVCODSRCCD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IWCHIERHDR-ISDELETED table field - Checkbox
▼
Description: Checkbox Field Name: ISDELETED Data Element: XFELD Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWCHIERHDR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MCHN_CVR_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCHN_CVR_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSRCSLIST-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCSLIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PASQNC_GRP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PASQNC_GRP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMRCACTYCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMRCACTYCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMRCACTYLT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMRCACTYLT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRACCTWI_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRACCTWI_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCFINRPOACC-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCFINRPOACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMLSGRAPHOV-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: PS_S4_LOEVM Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMLSGRAPHOV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMPRITMDEX-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPRITMDEX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPIRPOLMASS-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPIRPOLMASS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSRCSLISTTP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRCSLISTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DTWRKCTRGRP-ISDELETED table field - Checkbox
▼
Description: Checkbox Field Name: ISDELETED Data Element: XFELD Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DTWRKCTRGRP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IAINOBJLINK-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: DEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IAINOBJLINK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBOMITEMSTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOMITEMSTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICFINRPOACC-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFINRPOACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IIBASEOWNER-ISDELETED table field - Yes/No (X/ )
▼
Description: Yes/No (X/ ) Field Name: ISDELETED Data Element: OAX Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: X MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IIBASEOWNER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IINSPPLOPTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPPLOPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTNOTIF-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTNOTIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMSESAPI01-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMSESAPI01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMSTRRCPACT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRCPACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMSTRRCPOPR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRCPOPR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMSTRRCPPHS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRCPPHS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFCAUSE-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFCAUSE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPASQNC_GRP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPASQNC_GRP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRITMAPI01-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITMAPI01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURREQNITM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYNTFCAU-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNTFCAU table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYNTFITM-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNTFITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRTGCOMPALC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGCOMPALC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRTGMTLASGN-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGMTLASGN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDEFECT_TP-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEFECT_TP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRCSLCCODE-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRCSLCCODE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUPLRLBUPA-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPLRLBUPA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEIRHEADERX-ISDELETED table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: ISDELETED Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEIRHEADERX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSRCSLBUPA-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCSLBUPA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLIST-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PASQNC_GRPD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PASQNC_GRPD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PIBASEOWNER-ISDELETED table field - Yes/No (X/ )
▼
Description: Yes/No (X/ ) Field Name: ISDELETED Data Element: OAX Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: X MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PIBASEOWNER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPIRPOLMASS-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPIRPOLMASS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURREQNITM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURREQNITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
QINSPPLOP_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINSPPLOP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SCPRSREVERT-ISDELETED table field - Boolean Variable (X=True, Space=False)
▼
Description: Boolean Variable (X=True, Space=False) Field Name: ISDELETED Data Element: SAP_BOOL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SAP_BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCPRSREVERT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UEKPO_DISTR-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UEKPO_DISTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VFCLMMMEBKN-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VFCLMMMEBKN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VFCLMMMEKKN-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VFCLMMMEKKN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ACNTRLPCTRHD-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACNTRLPCTRHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ACNTRLPCTRID-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACNTRLPCTRID table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
APURCTRACCNT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURCTRACCNT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ASRVCENTRSHT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASRVCENTRSHT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNOTIFACTVTP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNOTIFACTVTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CONNSYSCHNGS-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CONNSYSCHNGS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPASQNCMCTWD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPASQNCMCTWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPASQNCMGRWD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPASQNCMGRWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_L_DEFECT-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_DEFECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_U_DEFECT-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_DEFECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTXIIPTITM-ISDELETED table field - China Tax Invoice Deleted
▼
Description: China Tax Invoice Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTXIIPTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTXIIPTMNG-ISDELETED table field - China Tax Invoice Deleted
▼
Description: China Tax Invoice Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTXIIPTMNG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTTLOPTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTTLOPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMEMORECORDT-ISDELETED table field - Deleted
▼
Description: Deleted Field Name: ISDELETED Data Element: FQM_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FQM_DELETED MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMEMORECORDT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMSTRRECPHDR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRECPHDR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INFREC_HDR_D-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INFREC_HDR_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPHYINVGRFLD-ISDELETED table field - Deletion indicator
▼
Description: Deletion indicator Field Name: ISDELETED Data Element: OII_DELIND Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPHYINVGRFLD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBOOOPERCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPERCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRACCTASSGB-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCTASSGB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRITEMAPI01-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITEMAPI01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRITEMBASIC-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITEMBASIC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRODNRTGOPR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRODNRTGOPR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURCTRACCNT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURCTRACCNT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURREQNACCT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNACCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQMNOTIFCUBE-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQMNOTIFCUBE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRTGOPBSCESH-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGOPBSCESH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRTGSEQUENCE-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGSEQUENCE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRCSLBUPATP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRCSLBUPATP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRCSLMATGRP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRCSLMATGRP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IVCHODTXTBSC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVCHODTXTBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IWORKPCKGALL-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWORKPCKGALL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IWRKCTRGROUP-ISDELETED table field - Checkbox
▼
Description: Checkbox Field Name: ISDELETED Data Element: XFELD Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWRKCTRGROUP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTNTFTO_D-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTNTFTO_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSRCSLCCODE-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCSLCCODE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLBP_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLBP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLBUPA-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLBUPA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PASQNC_CSTRT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PASQNC_CSTRT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCNTXIIPTITM-ISDELETED table field - China Tax Invoice Deleted
▼
Description: China Tax Invoice Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCNTXIIPTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PNOTIFSEARCH-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNOTIFSEARCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPPBOOOPERCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPPBOOOPERCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURGREQN_VH-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURGREQN_VH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRHIACCTWI_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRHIACCTWI_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PURREQNITM_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURREQNITM_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
QIPDPCHARC_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QIPDPCHARC_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
QIPOPCHARC_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QIPOPCHARC_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RMODPRODSPEC-ISDELETED table field - Deletion Indicator of a Model Product Specification
▼
Description: Deletion Indicator of a Model Product Specification Field Name: ISDELETED Data Element: MMPUR_MPS_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RMODPRODSPEC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SCPRSREVERTD-ISDELETED table field - Boolean Variable (X=True, Space=False)
▼
Description: Boolean Variable (X=True, Space=False) Field Name: ISDELETED Data Element: SAP_BOOL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SAP_BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCPRSREVERTD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SCPRSREVERTI-ISDELETED table field - Boolean Variable (X=True, Space=False)
▼
Description: Boolean Variable (X=True, Space=False) Field Name: ISDELETED Data Element: SAP_BOOL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SAP_BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCPRSREVERTI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
V_DEF_BO2ACT-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_DEF_BO2ACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CGBPRMAINTITM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGBPRMAINTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMAINTNOTIFTP-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMAINTNOTIFTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMAINTNOTIFVH-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMAINTNOTIFVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMPESFODEFECT-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPESFODEFECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNTFCAUSETETP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNTFCAUSETETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPASQNCMCCTWD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPASQNCMCCTWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPASQNCMCGRWD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPASQNCMCGRWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRODSPLYITEM-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: VDM_PKLKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRODSPLYITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURREQITEMFS-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQITEMFS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CQLTYNOTIFFDP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYNOTIFFDP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CQNOTIFTSKFDP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQNOTIFTSKFDP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSUPLRLBUPATP-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPLRLBUPATP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCD_ORGIDS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: EHPRC_IMDS_DEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: EHPRC_IMDS_DEL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCD_ORGIDS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCD_ORGPER-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: EHPRC_IMDS_DEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: EHPRC_IMDS_DEL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCD_ORGPER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCS_ORGIDS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: EHPRC_IMDS_DEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: EHPRC_IMDS_DEL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCS_ORGIDS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCS_ORGPER-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: EHPRC_IMDS_DEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: EHPRC_IMDS_DEL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCS_ORGPER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCV_OORGID-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: EHPRC_IMDS_DEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: EHPRC_IMDS_DEL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCV_OORGID table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCV_ORGIDS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: EHPRC_IMDS_DEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: EHPRC_IMDS_DEL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCV_ORGIDS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_L_PURREQN-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_PURREQN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_U_PURREQN-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_PURREQN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FDP_QM_DEFECT-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FDP_QM_DEFECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBASPRICEQUOT-ISDELETED table field - Price Quotation Logically Deleted
▼
Description: Price Quotation Logically Deleted Field Name: ISDELETED Data Element: TBA_PRICEQUOT_DELETION_IND Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBASPRICEQUOT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTRLRFQIDIS-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLRFQIDIS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICPOACCTASSTP-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICPOACCTASSTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IINSPPLMASSGV-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPPLMASSGV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ILOFPRICEQUOT-ISDELETED table field - Price Quotation Logically Deleted
▼
Description: Price Quotation Logically Deleted Field Name: ISDELETED Data Element: TBA_PRICEQUOT_DELETION_IND Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILOFPRICEQUOT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTNTFTETP-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTNTFTETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTORDOPTP-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTORDOPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTTLOPPRT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTTLOPPRT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMEMOMSTRDATA-ISDELETED table field - Deleted
▼
Description: Deleted Field Name: ISDELETED Data Element: FQM_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FQM_DELETED MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMEMOMSTRDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGORDDEFREC-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGORDDEFREC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMPUROACCASS-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPUROACCASS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMSESITAPI01-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMSESITAPI01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMSTRRCPOPBOM-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRCPOPBOM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFICATION-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFICATION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFITTECTP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFITTECTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INTFCAUSETETP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INTFCAUSETETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INTFTASKTECTP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INTFTASKTECTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPACTLGAUTGRP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPACTLGAUTGRP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPACTLGAUTVAL-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPACTLGAUTVAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPASQNC_CSTRT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPASQNC_CSTRT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPASQNC_GRPTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPASQNC_GRPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPCACCTASSGMT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPCACCTASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPDACCTASSGMT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPDACCTASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPHYINVVMRFLD-ISDELETED table field - Deletion indicator
▼
Description: Deletion indicator Field Name: ISDELETED Data Element: OII_DELIND Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPHYINVVMRFLD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPMORDOPERDEX-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPMORDOPERDEX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBOOOPPRTCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPPRTCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPKANBANCONT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: VDM_PKLKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPKANBANCONT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRACCTASSGMT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCTASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRACCTWRKITM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCTWRKITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRMTHBPRITEM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRMTHBPRITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURGINFORECD-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURGINFORECD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYINPROCMT-ISDELETED table field - Deletion Flag
▼
Description: Deletion Flag Field Name: ISDELETED Data Element: QLOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYINPROCMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYNTFITMTP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNTFITMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRTGCOMPALLOC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGCOMPALLOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDEFECT_TP_D-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEFECT_TP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUPLRLBUPATP-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPLRLBUPATP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUPLRLCOCODE-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPLRLCOCODE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IVCODSRCCDBSC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVCODSRCCDBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IVWRKFLWSTAGE-ISDELETED table field - Logical Deletion Flag
▼
Description: Logical Deletion Flag Field Name: ISDELETED Data Element: SWF_FLEX_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVWRKFLWSTAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTORDSOP_D-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTORDSOP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_HCM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_HCM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSRCSLBUPA_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCSLBUPA_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSRCSLIST2_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCSLIST2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSRCSLMATGRP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCSLMATGRP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLBP2_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLBP2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLCCODE-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLCCODE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLIST_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLIST_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PACTLG_AUTGRP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACTLG_AUTGRP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PACTLG_AUTVAL-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACTLG_AUTVAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PASQNC_ASSGMT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PASQNC_ASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PASQNC_CSTRTD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PASQNC_CSTRTD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PBASPRICEQUOT-ISDELETED table field - Price Quotation Logically Deleted
▼
Description: Price Quotation Logically Deleted Field Name: ISDELETED Data Element: TBA_PRICEQUOT_DELETION_IND Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PBASPRICEQUOT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PEPREVIEWDATA-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEPREVIEWDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PLOFPRICEQUOT-ISDELETED table field - Price Quotation Logically Deleted
▼
Description: Price Quotation Logically Deleted Field Name: ISDELETED Data Element: TBA_PRICEQUOT_DELETION_IND Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLOFPRICEQUOT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMFGORDDEFREC-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMFGORDDEFREC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
POACCTASSTP_D-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POACCTASSTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PURCTRACCNT_D-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURCTRACCNT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PURREQNACCT_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURREQNACCT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
V_QTSK_DR2ACT-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_QTSK_DR2ACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
API_KANBANCONT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: VDM_PKLKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP API_KANBANCONT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ASCHAGRMTACCNT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASCHAGRMTACCNT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIN_AVCI_DOCE-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIN_AVCI_DOCE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIN_AVSI_DOCE-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIN_AVSI_DOCE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIN_AVSO_DOCE-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIN_AVSO_DOCE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CINSPPLDPCHARC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPPLDPCHARC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMPURORDAADEX-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPURORDAADEX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNTRLRFQDIST_D-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNTRLRFQDIST_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRACCTASSMTWI-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRACCTASSMTWI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRODSPLYITEMD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: VDM_PKLKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRODSPLYITEMD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURINFRECMASS-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURINFRECMASS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CQLTYINPROCMNG-ISDELETED table field - Quality Info Records Flagged for Deletion
▼
Description: Quality Info Records Flagged for Deletion Field Name: ISDELETED Data Element: VDM_QLTYINFORECORDDDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYINPROCMNG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CQLTYNTFITMFDP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYNTFITMFDP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSRCSLCOCODETP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRCSLCOCODETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSRCSLMATLGRTP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRCSLMATLGRTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSSPPRMAINTITM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSSPPRMAINTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_L_PURORDER-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_PURORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_U_PURORDER-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_PURORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBOMITEMHDRCHG-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOMITEMHDRCHG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBOMITEMSBASIC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOMITEMSBASIC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBOMITEMSDRAFT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOMITEMSDRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTRLPCONDSTR-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLPCONDSTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTRLQTNDISTR-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLQTNDISTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTRLRFQDISTP-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLRFQDISTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IINFRECWITHORG-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINFRECWITHORG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IINSPOPDPCHARC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPOPDPCHARC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IKBOMITEMAPITP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IKBOMITEMAPITP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGARCTPDRAFT-ISDELETED table field - Data Record Was Deleted
▼
Description: Data Record Was Deleted Field Name: ISDELETED Data Element: QGEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGARCTPDRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGWORKINSTTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGWORKINSTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMCPUROACCASS-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMCPUROACCASS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMPURUSRCRTTX-ISDELETED table field - Indicates if the field can be deleted or not
▼
Description: Indicates if the field can be deleted or not Field Name: ISDELETED Data Element: MMPUR_ANA_USRCRT_DELETE_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_USRCRT_DELETE_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPURUSRCRTTX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPCKTLOPALLOC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPCKTLOPALLOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMSTRRCPRELSHP-ISDELETED table field - Asset class marked for deletion
▼
Description: Asset class marked for deletion Field Name: ISDELETED Data Element: LOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRCPRELSHP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMSTRRCPSECRSC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRCPSECRSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFACTYDATA-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFACTYDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFTASKDATA-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFTASKDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPASQNC_ASSGMT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPASQNC_ASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPOACCFINPOACC-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPOACCFINPOACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBOMEXPLDATE-ISDELETED table field - Item is deleted
▼
Description: Item is deleted Field Name: ISDELETED Data Element: XLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOMEXPLDATE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBOOOPBOMICS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPBOMICS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPMFGORDOPPRT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMFGORDOPPRT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRODNRTGSUBOP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRODNRTGSUBOP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURCTRACCNTWD-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURCTRACCNTWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURREQNACCTWD-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNACCTWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYDFCTUNION-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYDFCTUNION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRTGHDRSRCHMOD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGHDRSRCHMOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRTGMATSRCHMOD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGMATSRCHMOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRTGPRTSRCHMOD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGPRTSRCHMOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRTGSEQSRCHMOD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGSEQSRCHMOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDEFECT_TP_DR-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEFECT_TP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPPLANEDIT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANEDIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMEMORECORDTP-ISDELETED table field - Deleted
▼
Description: Deleted Field Name: ISDELETED Data Element: FQM_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FQM_DELETED MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMEMORECORDTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRCSLCOCODETP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRCSLCOCODETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRCSLMATLGRTP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRCSLMATLGRTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUPLRLMATLGRP-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPLRLMATLGRP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IVARCNFTBLLINE-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVARCNFTBLLINE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IWRKITMPRINFRE-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWRKITMPRINFRE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTORDCOMP_D-ISDELETED table field - Item is deleted
▼
Description: Item is deleted Field Name: ISDELETED Data Element: XLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTORDCOMP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTORDOPER_D-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTORDOPER_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_EXT_EBAN-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_EXT_EBAN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_EXT_EBKN-ISDELETED table field - Asset class marked for deletion
▼
Description: Asset class marked for deletion Field Name: ISDELETED Data Element: LOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_EXT_EBKN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_RULE_DEF-ISDELETED table field - Boolean Variables (X=true, space=false)
▼
Description: Boolean Variables (X=true, space=false) Field Name: ISDELETED Data Element: BOOLEAN_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_RULE_DEF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PR_ITM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_ITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMRENEGOITEM_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMRENEGOITEM_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSRCSLBUPA2_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCSLBUPA2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSRCSLBUSPART-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCSLBUSPART table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSRCSLCCODE_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCSLCCODE_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLBUPA_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLBUPA_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLIST2_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLIST2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PACTLG_AUTGRPD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACTLG_AUTGRPD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PACTLG_AUTVALD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACTLG_AUTVALD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PASQNC_ASSGMTD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PASQNC_ASSGMTD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PBASPRICEQUOTL-ISDELETED table field - Price Quotation Logically Deleted
▼
Description: Price Quotation Logically Deleted Field Name: ISDELETED Data Element: TBA_PRICEQUOT_DELETION_IND Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PBASPRICEQUOTL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PBOMCOMPONENTS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PBOMCOMPONENTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCCTLGCLFNCVBV-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCTLGCLFNCVBV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCNTRLPCONDSTR-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCNTRLPCONDSTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PDACCTASSGMT_D-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDACCTASSGMT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PINFRECWITHORG-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PINFRECWITHORG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PLOFPRICEQUOTL-ISDELETED table field - Price Quotation Logically Deleted
▼
Description: Price Quotation Logically Deleted Field Name: ISDELETED Data Element: TBA_PRICEQUOT_DELETION_IND Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLOFPRICEQUOTL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMFGDEFECTHIST-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMFGDEFECTHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
QLTYINPROCMT_D-ISDELETED table field - Deletion Flag
▼
Description: Deletion Flag Field Name: ISDELETED Data Element: QLOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QLTYINPROCMT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RCNTRLQTNDISTR-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCNTRLQTNDISTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TXI_BNDG_HDRTP-ISDELETED table field - China Tax Invoice Binding Deleted
▼
Description: China Tax Invoice Binding Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_BND_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TXI_BNDG_HDRTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TXI_BNDG_ITMTP-ISDELETED table field - China Tax Invoice Binding Deleted
▼
Description: China Tax Invoice Binding Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_BND_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TXI_BNDG_ITMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ASRVCENTRSHTITM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASRVCENTRSHTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCHGIMPLNGROUOP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGIMPLNGROUOP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCNTXIBNDGHDRTP-ISDELETED table field - China Tax Invoice Binding Deleted
▼
Description: China Tax Invoice Binding Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_BND_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTXIBNDGHDRTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCNTXIBNDGITMTP-ISDELETED table field - China Tax Invoice Binding Deleted
▼
Description: China Tax Invoice Binding Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_BND_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTXIBNDGITMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCNTXIIPTVATCAT-ISDELETED table field - China Tax Input VAT Category Is Obsolete
▼
Description: China Tax Input VAT Category Is Obsolete Field Name: ISDELETED Data Element: FICNTAX_INPUT_VAT_CAT_OBSOLETE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTXIIPTVATCAT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMNGCCTLGAGRPTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMNGCCTLGAGRPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMNGCCTLGAVALTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMNGCCTLGAVALTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMTORDSUBOPERTP-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMTORDSUBOPERTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNTRLPCHDISTR_D-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNTRLPCHDISTR_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNTRLQTNDISTR_D-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNTRLQTNDISTR_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPCHIERITMDISTR-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPCHIERITMDISTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOACCTASSNTP_D-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOACCTASSNTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRECONTRACTVALQ-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRECONTRACTVALQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSCHAGRMTACCTWD-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSCHAGRMTACCTWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSRCSLISTBUPATP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRCSLISTBUPATP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSUPLRLBPPROPTP-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPLRLBPPROPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSUPLRLCOCODETP-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPLRLCOCODETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_L_QLTYNOTIF-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_QLTYNOTIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_U_QLTYNOTIF-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_QLTYNOTIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBOMITEMDRAFTV2-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOMITEMDRAFTV2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBOODPCHSPECVER-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOODPCHSPECVER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBOOMATASSIGNCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOOMATASSIGNCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICHGIMPLNGROUOP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICHGIMPLNGROUOP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTXIBNDGHDRTP-ISDELETED table field - China Tax Invoice Binding Deleted
▼
Description: China Tax Invoice Binding Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_BND_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTXIBNDGHDRTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTXIBNDGITMTP-ISDELETED table field - China Tax Invoice Binding Deleted
▼
Description: China Tax Invoice Binding Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_BND_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTXIBNDGITMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTXIIPTVATCAT-ISDELETED table field - China Tax Input VAT Category Is Obsolete
▼
Description: China Tax Input VAT Category Is Obsolete Field Name: ISDELETED Data Element: FICNTAX_INPUT_VAT_CAT_OBSOLETE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTXIIPTVATCAT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IIBASEHIERARCHY-ISDELETED table field - Yes/No (X/ )
▼
Description: Yes/No (X/ ) Field Name: ISDELETED Data Element: OAX Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: X MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IIBASEHIERARCHY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IINSPOPDPCHARTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPOPDPCHARTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTBOMITEMTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTBOMITEMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTNOTIFACTV-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTNOTIFACTV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTNOTIFITEM-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTNOTIFITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTNOTIFTASK-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTNOTIFTASK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTNTFTECOBJ-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTNTFTECOBJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMASTERWARRANTY-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LVORM Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMASTERWARRANTY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMEMORECORDBASE-ISDELETED table field - Deleted
▼
Description: Deleted Field Name: ISDELETED Data Element: FQM_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FQM_DELETED MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMEMORECORDBASE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGBOOOPERCHST-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBOOOPERCHST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMPURREQACCASS-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPURREQACCASS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMSTRRCPCOMPALC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRCPCOMPALC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMSTRRCPMTLASGN-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRCPMTLASGN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMTORDOPRTECOBJ-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMTORDOPRTECOBJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMTORDSOPTECOBJ-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMTORDSOPTECOBJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMTORDSUBOPERTP-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMTORDSUBOPERTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INFRECWITHORG_D-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INFRECWITHORG_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFCAUSEDATA-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFCAUSEDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFITTECHOBJ-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFITTECHOBJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INTFTASKTECHOBJ-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INTFTASKTECHOBJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPACTLGAUTGRPTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPACTLGAUTGRPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPACTLGAUTVALTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPACTLGAUTVALTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPASQNC_CSTRTTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPASQNC_CSTRTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPCKTLOPALCDATA-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPCKTLOPALCDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBILLOFOPERCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBILLOFOPERCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBOOCHARCVERS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOCHARCVERS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBOOOPCHARCCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPCHARCCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBOOOPERBASIC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPERBASIC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBOOSUBOPERCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOSUBOPERCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRACCASMTAPI01-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCASMTAPI01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRACCTWRKITMWD-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCTWRKITMWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRMTAUTOMNRULE-ISDELETED table field - Boolean Variables (X=true, space=false)
▼
Description: Boolean Variables (X=true, space=false) Field Name: ISDELETED Data Element: BOOLEAN_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRMTAUTOMNRULE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRODNRTGVERSWF-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRODNRTGVERSWF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROJMLSTNVERSN-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJMLSTNVERSN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRENEGOLISTITEM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRENEGOLISTITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRTGOPSEQALCESH-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGOPSEQALCESH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCHAGRMTACCTWD-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCHAGRMTACCTWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISQUALITYTASKTP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYTASKTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRVCENTRSHTBSC-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVCENTRSHTBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUPLRLBUPAPROP-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPLRLBUPAPROP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUPLRLCOCODETP-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPLRLCOCODETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUPUSRDEFCRTCT-ISDELETED table field - Indicates if the field can be deleted or not
▼
Description: Indicates if the field can be deleted or not Field Name: ISDELETED Data Element: MMPUR_ANA_USRCRT_DELETE_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_USRCRT_DELETE_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPUSRDEFCRTCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISWORKFLOWSTAGE-ISDELETED table field - Logical Deletion Flag
▼
Description: Logical Deletion Flag Field Name: ISDELETED Data Element: SWF_FLEX_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISWORKFLOWSTAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IVARCNFTBLLNBSC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVARCNFTBLLNBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTITEMACTY_D-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTITEMACTY_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTNOTIFITM_D-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTNOTIFITM_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPURANACRTSCRD-ISDELETED table field - Indicates if the field can be deleted or not
▼
Description: Indicates if the field can be deleted or not Field Name: ISDELETED Data Element: MMPUR_ANA_USRCRT_DELETE_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_USRCRT_DELETE_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPURANACRTSCRD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_ACT_INPUT-ISDELETED table field - Boolean Variables (X=true, space=false)
▼
Description: Boolean Variables (X=true, space=false) Field Name: ISDELETED Data Element: BOOLEAN_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_ACT_INPUT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_CPR_S_ITM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CPR_S_ITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_MPS_HDR_D-ISDELETED table field - Deletion Indicator of a Model Product Specification
▼
Description: Deletion Indicator of a Model Product Specification Field Name: ISDELETED Data Element: MMPUR_MPS_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_MPS_HDR_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SA_ACCT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SA_ACCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SES_ACC-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SES_ACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SES_HDR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SES_HDR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SES_ITM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SES_ITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSRCSLCCODE2_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCSLCCODE2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSRCSLMATGRP_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCSLMATGRP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLBUPA2_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLBUPA2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLBUSPART-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLBUSPART table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLCCODE_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLCCODE_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLMATLGRP-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLMATLGRP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCCTLGCLFNCVDSC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCTLGCLFNCVDSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCNTXIIPTVATCAT-ISDELETED table field - China Tax Input VAT Category Is Obsolete
▼
Description: China Tax Input VAT Category Is Obsolete Field Name: ISDELETED Data Element: FICNTAX_INPUT_VAT_CAT_OBSOLETE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCNTXIIPTVATCAT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PEPREVIEWDATAWS-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEPREVIEWDATAWS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PIBASEHIERARCHY-ISDELETED table field - Yes/No (X/ )
▼
Description: Yes/No (X/ ) Field Name: ISDELETED Data Element: OAX Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: X MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PIBASEHIERARCHY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOMAINTITMLIST-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOMAINTITMLIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPREQITMACCMNTR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPREQITMACCMNTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPROPENQUANCALC-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROPENQUANCALC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURREQITEMMNTR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURREQITEMMNTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/CPD/S_SC_REVIEW-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /CPD/S_SC_REVIEW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MERP/PP_POSTAGG-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PP_POSTAGG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MERP/PP_PO_STAT-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PP_PO_STAT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
AFIINTERNALORDER-ISDELETED table field - Deletion Flag
▼
Description: Deletion Flag Field Name: ISDELETED Data Element: AUFLOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AFIINTERNALORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
APASQNC_ASSGMTTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APASQNC_ASSGMTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
APURORDACCASSIGN-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURORDACCASSIGN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ASRVCENTRSHTACCT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASRVCENTRSHTACCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCHGIMPLNGROUMBM-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGIMPLNGROUMBM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIGRIRPURDOCITM-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIGRIRPURDOCITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMPURINFORECDEX-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPURINFORECDEX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNTRLPCDISTRTP_D-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNTRLPCDISTRTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNV_2010C_MAPX4T-ISDELETED table field - Data element for domain BOOLE: TRUE (='X') and FALSE (=' ')
▼
Description: Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') Field Name: ISDELETED Data Element: BOOLE_D Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNV_2010C_MAPX4T table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNV_2010C_MAP_X4-ISDELETED table field - Data element for domain BOOLE: TRUE (='X') and FALSE (=' ')
▼
Description: Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') Field Name: ISDELETED Data Element: BOOLE_D Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNV_2010C_MAP_X4 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
COBJPGMAINTNOTIF-ISDELETED table field - Checkbox
▼
Description: Checkbox Field Name: ISDELETED Data Element: XFELD Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COBJPGMAINTNOTIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPACTLGAUTGRPOVW-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPACTLGAUTGRPOVW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOMAINTVHINFREC-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMAINTVHINFREC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRHIACCTASSMTWI-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRHIACCTASSMTWI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURREQLMTITEMFS-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQLMTITEMFS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSAP_S_ITEM_DATA-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSAP_S_ITEM_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSUPLRLMATLGRPTP-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPLRLMATLGRPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EDESKIFINSTANCES-ISDELETED table field - Deleted
▼
Description: Deleted Field Name: ISDELETED Data Element: EDESKIFINSTANCEISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EDESKIFINSTANCES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_L_INFORECORD-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_INFORECORD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_L_SRVENTRSHT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_SRVENTRSHT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_U_INFORECORD-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_INFORECORD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_U_SRVENTRSHT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_SRVENTRSHT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBOOCINSPSPUNION-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOOCINSPSPUNION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICHGIMPLNGROUMBM-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICHGIMPLNGROUMBM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTRLQTNDISTRTP-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLQTNDISTRTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTXIBNDGRECDDR-ISDELETED table field - China Tax Invoice Binding Deleted
▼
Description: China Tax Invoice Binding Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_BND_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTXIBNDGRECDDR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICVDOCSTRUCTITEM-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICVDOCSTRUCTITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIINTERNALORDER-ISDELETED table field - Deletion Flag
▼
Description: Deletion Flag Field Name: ISDELETED Data Element: AUFLOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIINTERNALORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IINFRECWITHORGWD-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINFRECWITHORGWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IINSPPLOPASSGVRS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPPLOPASSGVRS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IJPTAXALLCRESULT-ISDELETED table field - Tax Reallocation deletion flag
▼
Description: Tax Reallocation deletion flag Field Name: ISDELETED Data Element: GLO_JP_DELFLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IJPTAXALLCRESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IKBOMITEMAPITP_1-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IKBOMITEMAPITP_1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTBOMITEMCHG-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTBOMITEMCHG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTNOTIF002TP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTNOTIF002TP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTNOTIFCAUSE-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTNOTIFCAUSE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTTASKLISTTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTTASKLISTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFBOOSEQOPASSCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFBOOSEQOPASSCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGBILLOFOPERCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBILLOFOPERCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGBOOMATASGNCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBOOMATASGNCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGBOOOPBOMITCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBOOOPBOMITCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGBOOOPPRTCHST-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBOOOPPRTCHST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGBOOSEQNCCHST-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBOOSEQNCCHST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGBOOSUBOPCHST-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBOOSUBOPCHST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGORDOPTRGGRPT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: PS_S4_LOEVM Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGORDOPTRGGRPT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMPURORDAAAPI01-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPURORDAAAPI01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMPURORDITEMENH-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPURORDITEMENH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMRPPURREQHNDSTS-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPPURREQHNDSTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFACTVTECOBJ-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFACTVTECOBJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INTFCAUSETECHOBJ-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INTFCAUSETECHOBJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IORDPRODNRSCTOOL-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IORDPRODNRSCTOOL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPASQNC_ASSGMTTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPASQNC_ASSGMTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPDACCTASSGMTAPI-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPDACCTASSGMTAPI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBOOOPDCHARCCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPDCHARCCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBOOOPDOCPRTCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPDOCPRTCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBOOOPEQUPRTCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPEQUPRTCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBOOOPMATPRTCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPMATPRTCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBOOOPMISPRTCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPMISPRTCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBOOSEQOPASSCS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOSEQOPASSCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBOOSEQUENCECS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOSEQUENCECS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRACCASGMTAPI01-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCASGMTAPI01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRHDITACTWRKITM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRHDITACTWRKITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRHRITACWRKITWD-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRHRITACWRKITWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRMTHBPRADDLDET-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRMTHBPRADDLDET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRMTHBPRITAPI01-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRMTHBPRITAPI01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROCMTHUBPRITEM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROCMTHUBPRITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRODNRTGVERSDAT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRODNRTGVERSDAT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRODNRTGVERSWFD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRODNRTGVERSWFD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRSSPACCTASSGMT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRSSPACCTASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURGDOCSUPLCONF-ISDELETED table field - Supplier Confirmation Deletion Indicator
▼
Description: Supplier Confirmation Deletion Indicator Field Name: ISDELETED Data Element: BBLOE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURGDOCSUPLCONF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYNOTIFKFCUBE-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNOTIFKFCUBE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRECONTRACTVALID-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRECONTRACTVALID table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRTGCMPALCSRHMOD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGCMPALCSRHMOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBOM_COMPONENTS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBOM_COMPONENTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCHEDGAGRMTACCT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCHEDGAGRMTACCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMEMORECORDTP_D-ISDELETED table field - Deleted
▼
Description: Deleted Field Name: ISDELETED Data Element: FQM_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FQM_DELETED MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMEMORECORDTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRVENTSHTITMBSC-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVENTSHTITMBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRVETRSHTACCBSC-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVETRSHTACCBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUPLRLBUPPROPTP-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPLRLBUPPROPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUPLRLMATLGRPTP-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPLRLMATLGRPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ITECHNICALO000TP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITECHNICALO000TP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ITECHNICALOBJECT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITECHNICALOBJECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ITSKLSTTOEQALLOC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITSKLSTTOEQALLOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ITSKLSTTOFLALLOC-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITSKLSTTOFLALLOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IVARCNFTBLSTATUS-ISDELETED table field - Status Indicator That Variant Table is Marked for Deletion
▼
Description: Status Indicator That Variant Table is Marked for Deletion Field Name: ISDELETED Data Element: VTARCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVARCNFTBLSTATUS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IVCM_CHAINBOITEM-ISDELETED table field - Boolean Value
▼
Description: Boolean Value Field Name: ISDELETED Data Element: VCM_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: VCM_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVCM_CHAINBOITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IVCM_CHAINBOITTP-ISDELETED table field - Boolean Value
▼
Description: Boolean Value Field Name: ISDELETED Data Element: VCM_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: VCM_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVCM_CHAINBOITTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTITEMCAUSE_D-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTITEMCAUSE_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTNOTIFACTV_D-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTNOTIFACTV_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTNOTIFCAUS_D-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTNOTIFCAUS_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTNOTIFITEM_D-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTNOTIFITEM_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTNOTIFTASK_D-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTNOTIFTASK_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTNTFTECOBJ_D-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTNTFTECOBJ_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPURANA_CRTSCRD-ISDELETED table field - Indicates if the field can be deleted or not
▼
Description: Indicates if the field can be deleted or not Field Name: ISDELETED Data Element: MMPUR_ANA_USRCRT_DELETE_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_USRCRT_DELETE_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPURANA_CRTSCRD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_ACT_PARAMS-ISDELETED table field - Boolean Variables (X=true, space=false)
▼
Description: Boolean Variables (X=true, space=false) Field Name: ISDELETED Data Element: BOOLEAN_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_ACT_PARAMS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_ACT_PREREQ-ISDELETED table field - Boolean Variables (X=true, space=false)
▼
Description: Boolean Variables (X=true, space=false) Field Name: ISDELETED Data Element: BOOLEAN_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_ACT_PREREQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_ANA_CRTSCR-ISDELETED table field - Indicates if the field can be deleted or not
▼
Description: Indicates if the field can be deleted or not Field Name: ISDELETED Data Element: MMPUR_ANA_USRCRT_DELETE_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_USRCRT_DELETE_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_ANA_CRTSCR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_EXT_S_EKKN-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_EXT_S_EKKN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_MPS_HEADER-ISDELETED table field - Deletion Indicator of a Model Product Specification
▼
Description: Deletion Indicator of a Model Product Specification Field Name: ISDELETED Data Element: MMPUR_MPS_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_MPS_HEADER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_RULE_ACVTY-ISDELETED table field - Boolean Variables (X=true, space=false)
▼
Description: Boolean Variables (X=true, space=false) Field Name: ISDELETED Data Element: BOOLEAN_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_RULE_ACVTY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_RUL_ACTION-ISDELETED table field - Boolean Variables (X=true, space=false)
▼
Description: Boolean Variables (X=true, space=false) Field Name: ISDELETED Data Element: BOOLEAN_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_RUL_ACTION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_RUL_CONSYS-ISDELETED table field - Boolean Variables (X=true, space=false)
▼
Description: Boolean Variables (X=true, space=false) Field Name: ISDELETED Data Element: BOOLEAN_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_RUL_CONSYS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_RUL_CRTRIA-ISDELETED table field - Boolean Variables (X=true, space=false)
▼
Description: Boolean Variables (X=true, space=false) Field Name: ISDELETED Data Element: BOOLEAN_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_RUL_CRTRIA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CTR_ACCT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CTR_ACCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMRENEGOITEMLIST-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMRENEGOITEMLIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSRCSLBUSPART_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCSLBUSPART_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSRCSLMATGRP2_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCSLMATGRP2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLBPPROP_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLBPPROP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLBUPAPROP-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLBUPAPROP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLBUPRO2_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLBUPRO2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLCCODE2_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLCCODE2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLMATGR2_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLMATGR2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLMATGRP_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLMATGRP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLPRPCCODE-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLPRPCCODE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLPRPSP2_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLPRPSP2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLPRPSUPLR-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLPRPSUPLR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSUPLRLPRPSUP_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSUPLRLPRPSUP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MPES_EXEC_DEFECT-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPES_EXEC_DEFECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MPE_WI_VERSION_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPE_WI_VERSION_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MRCHDS_CAT_CVR_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MRCHDS_CAT_CVR_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PBOMCOMPWITHDATE-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PBOMCOMPWITHDATE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCCTLGCLFNCVDEL1-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCTLGCLFNCVDEL1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCCTLGCLFNCVDEL2-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCTLGCLFNCVDEL2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PDAMAGEANALYCUBE-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDAMAGEANALYCUBE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPCTRACCTASSGNMT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPCTRACCTASSGNMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURGREQNACCT_VH-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURGREQNACCT_VH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PURCTR_ITM_ACT_D-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURCTR_ITM_ACT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SCHEDAGRMTACCT_D-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCHEDAGRMTACCT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TECHNICALOBJEC_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TECHNICALOBJEC_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EDESKIFINSTANCES1-ISDELETED table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: ISDELETED Data Element: EDESKIFCHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EDESKIFINSTANCES1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPPLANPRTOPTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANPRTOPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMEMORECORDTP_DR-ISDELETED table field - Deleted
▼
Description: Deleted Field Name: ISDELETED Data Element: FQM_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FQM_DELETED MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMEMORECORDTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCTRACCOUNTWD-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRACCOUNTWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISQUALITYTASKTP_D-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYTASKTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPPLIERLISTTP1-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPPLIERLISTTP1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISWORKFLOWSTAGE_D-ISDELETED table field - Logical Deletion Flag
▼
Description: Logical Deletion Flag Field Name: ISDELETED Data Element: SWF_FLEX_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISWORKFLOWSTAGE_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OCI_ITM_MAP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OCI_ITM_MAP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_ITEM_DATA-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_ITEM_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VMMPUR_ANA_CRTSCR-ISDELETED table field - Indicates if the field can be deleted or not
▼
Description: Indicates if the field can be deleted or not Field Name: ISDELETED Data Element: MMPUR_ANA_USRCRT_DELETE_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_USRCRT_DELETE_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VMMPUR_ANA_CRTSCR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DTINF_S_PROCMAP_BF-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DTINF_S_PROCMAP_BF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCS_DPR_COMPANY-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: EHPRC_IMDS_DEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: EHPRC_IMDS_DEL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCS_DPR_COMPANY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPECTIONPLANTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONPLANTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCTRACCOUNTWD1-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRACCOUNTWD1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCTRACCOUNTWD2-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRACCOUNTWD2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISQUALITYTASKTP_DR-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYTASKTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISWORKFLOWTEMPLATE-ISDELETED table field - Logical Deletion Flag
▼
Description: Logical Deletion Flag Field Name: ISDELETED Data Element: SWF_FLEX_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISWORKFLOWTEMPLATE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_DATA_HCM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_DATA_HCM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_ACCOUNTING-ISDELETED table field - Asset class marked for deletion
▼
Description: Asset class marked for deletion Field Name: ISDELETED Data Element: LOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_ACCOUNTING table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_DISTR-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_DISTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_EXT_PR_HUB-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_PR_HUB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SSP_DRIVER-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_DRIVER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TSPURCHASEREQNITEM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCS_DPR_ORG_UNIT-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: EHPRC_IMDS_DEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: EHPRC_IMDS_DEL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCS_DPR_ORG_UNIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FCOS_INTERNAL_ORDER-ISDELETED table field - Deletion Flag
▼
Description: Deletion Flag Field Name: ISDELETED Data Element: AUFLOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCOS_INTERNAL_ORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPPLANOPCHARCTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANOPCHARCTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPPLANPRTOPTP_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANPRTOPTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCTRACCOUNTWD_D-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRACCOUNTWD_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPPLIERLISTTP1_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPPLIERLISTTP1_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISTECHNICALOBJECTTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTECHNICALOBJECTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISWORKCENTERGROUPTP-ISDELETED table field - Checkbox
▼
Description: Checkbox Field Name: ISDELETED Data Element: XFELD Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISWORKCENTERGROUPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPURREQPREOPDELLOG-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPURREQPREOPDELLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SSP_REQN_ITEM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SSP_REQN_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_EXT_ACC_HUB-ISDELETED table field - Asset class marked for deletion
▼
Description: Asset class marked for deletion Field Name: ISDELETED Data Element: LOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_ACC_HUB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_EXT_LOCALPR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_LOCALPR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PO_ITEM_ACC-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_ITEM_ACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SES_ACC_WFL-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SES_ACC_WFL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SES_HDR_WFL-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SES_HDR_WFL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SES_ITM_WFL-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SES_ITM_WFL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SSP_PR_ITEM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_PR_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESA_BOM_ITEM_CHANGES-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESA_BOM_ITEM_CHANGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ETO_PROBJ_S_BOM_ITEM-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ETO_PROBJ_S_BOM_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPECTIONPLANTP_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONPLANTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPPLANPRTOPTP_DR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANPRTOPTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCTRACCOUNTWD1_D-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRACCOUNTWD1_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCTRACCOUNTWD2_D-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRACCOUNTWD2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCTRACCOUNTWD3_D-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRACCOUNTWD3_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCTRACCOUNTWD_DR-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRACCOUNTWD_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPPLIERLISTTP1_DR-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPPLIERLISTTP1_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISWORKFLOWTEMPLATE_D-ISDELETED table field - Logical Deletion Flag
▼
Description: Logical Deletion Flag Field Name: ISDELETED Data Element: SWF_FLEX_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISWORKFLOWTEMPLATE_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_DOCLST_REQITEM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_DOCLST_REQITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_API_ITM-ISDELETED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: ISDELETED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_ITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CONTRACT_ACT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CONTRACT_ACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_EXT_LOCALACC-ISDELETED table field - Asset class marked for deletion
▼
Description: Asset class marked for deletion Field Name: ISDELETED Data Element: LOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_LOCALACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PR_ITEM_EXTR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_ITEM_EXTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SSP_REQ_ITEM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_REQ_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SPSHOPPINGCARTITEMBO-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SPSHOPPINGCARTITEMBO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TSPURCHASEREQNITEM_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNITEM_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DTINF_S_DBSCHEMA_JOIN-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DTINF_S_DBSCHEMA_JOIN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCS_DPR_ORG_PERSON-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: EHPRC_IMDS_DEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: EHPRC_IMDS_DEL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCS_DPR_ORG_PERSON table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTAXINVCBINDGHDRTP-ISDELETED table field - China Tax Invoice Binding Deleted
▼
Description: China Tax Invoice Binding Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_BND_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTAXINVCBINDGHDRTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTAXINVCBINDGITMTP-ISDELETED table field - China Tax Invoice Binding Deleted
▼
Description: China Tax Invoice Binding Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_BND_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTAXINVCBINDGITMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPECTIONPLANTP_DR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONPLANTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPPLANOPCHARCTP_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANOPCHARCTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPPLANOPERATIONTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANOPERATIONTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFICATIONTP-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSERVICEENTRYSHEETTP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSERVICEENTRYSHEETTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISTECHNICALOBJECTTP_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTECHNICALOBJECTTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISWORKCENTERGROUPTP_D-ISDELETED table field - Checkbox
▼
Description: Checkbox Field Name: ISDELETED Data Element: XFELD Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISWORKCENTERGROUPTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISWORKFLOWTEMPLATE_DR-ISDELETED table field - Logical Deletion Flag
▼
Description: Logical Deletion Flag Field Name: ISDELETED Data Element: SWF_FLEX_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISWORKFLOWTEMPLATE_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_MPS_HEADER_DATA-ISDELETED table field - Deletion Indicator of a Model Product Specification
▼
Description: Deletion Indicator of a Model Product Specification Field Name: ISDELETED Data Element: MMPUR_MPS_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_MPS_HEADER_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_PPR_S_UI_PRITEM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PPR_S_UI_PRITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_API_ITEM-ISDELETED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: ISDELETED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PR_EXTRACTION-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_EXTRACTION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PR_ODATA_ITEM-ISDELETED table field - Character field of length 6
▼
Description: Character field of length 6 Field Name: ISDELETED Data Element: CHAR6 Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: CHAR6 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_ODATA_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
QINSP_PLAN_CHARACT_CB-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINSP_PLAN_CHARACT_CB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TSPURCHASEREQNITEM_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNITEM_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DTINF_S_DBSCHEMA_TABLE-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DTINF_S_DBSCHEMA_TABLE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DTINF_S_GENERIC_HEADER-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DTINF_S_GENERIC_HEADER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_EX_AV_CI_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_EX_AV_CI_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_EX_AV_CI_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_EX_AV_CI_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_EX_AV_PO_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_EX_AV_PO_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_EX_AV_PO_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_EX_AV_PO_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_EX_AV_SI_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_EX_AV_SI_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_EX_AV_SI_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_EX_AV_SI_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_EX_AV_SO_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_EX_AV_SO_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_EX_AV_SO_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_EX_AV_SO_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_SX_AV_CI_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_SX_AV_CI_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_SX_AV_PO_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_SX_AV_PO_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_SX_AV_SI_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_SX_AV_SI_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_SX_AV_SO_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_SX_AV_SO_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBILLOFMATERIALITEMTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBILLOFMATERIALITEMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBILLOFMATERIALITEMWD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBILLOFMATERIALITEMWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPPLANOPCHARCTP_DR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANOPCHARCTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFACTIVITYTP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFACTIVITYTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMFGWORKINSTRUCTIONTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGWORKINSTRUCTIONTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODALLOCSQNCCSTRTTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCSQNCCSTRTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODALLOCSQNCGROUPTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCSQNCGROUPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODNRTGVERSWRKFLWTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODNRTGVERSWRKFLWTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISTECHNICALOBJECTTP_DR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTECHNICALOBJECTTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISWORKCENTERGROUPTP_DR-ISDELETED table field - Checkbox
▼
Description: Checkbox Field Name: ISDELETED Data Element: XFELD Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISWORKCENTERGROUPTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PR_ITEM_IMPORT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_ITEM_IMPORT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PR_RPL_DETAILS-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_RPL_DETAILS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SRCSL_BUPAF_EX-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SRCSL_BUPAF_EX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SPSHOPPINGCARTITEMBO_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SPSHOPPINGCARTITEMBO_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_BIZ_K-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_BIZ_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_CTR_K-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_CTR_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_SLN_K-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_SLN_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKK_INT_HIST_INTER_PARA-ISDELETED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: ISDELETED Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_INT_HIST_INTER_PARA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTAXINVCBINDGHDRTP_D-ISDELETED table field - China Tax Invoice Binding Deleted
▼
Description: China Tax Invoice Binding Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_BND_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTAXINVCBINDGHDRTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTAXINVCBINDGITMTP_D-ISDELETED table field - China Tax Invoice Binding Deleted
▼
Description: China Tax Invoice Binding Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_BND_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTAXINVCBINDGITMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPPLANOPERATIONTP_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANOPERATIONTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTENANCETASKLISTTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTENANCETASKLISTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFICATIONTP_D-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTORDERCOMPONENTTP-ISDELETED table field - Item is deleted
▼
Description: Item is deleted Field Name: ISDELETED Data Element: XLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDERCOMPONENTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTORDEROPERATIONTP-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDEROPERATIONTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMFGACTIONREASONCODETP-ISDELETED table field - Data Record Was Deleted
▼
Description: Data Record Was Deleted Field Name: ISDELETED Data Element: QGEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGACTIONREASONCODETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODALLOCSQNCASSGMTTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCSQNCASSGMTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODALLOCSQNCCSTRTWD1-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCSQNCCSTRTWD1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODALLOCSQNCGROUPWD1-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCSQNCGROUPWD1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSERVICEENTRYSHEETTP_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSERVICEENTRYSHEETTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_PREQUISITION_ITEM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PREQUISITION_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ITEM_BOPF_EXT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ITEM_BOPF_EXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_API_HDRDIS-ISDELETED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: ISDELETED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_HDRDIS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_API_ITMDIS-ISDELETED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: ISDELETED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_ITMDIS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_DISTR_LINE-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_DISTR_LINE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SRCSL_CCODEF_EX-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SRCSL_CCODEF_EX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SUPLRL_BUPAF_EX-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SUPLRL_BUPAF_EX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_CI_ROOT_K-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_CI_ROOT_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_PO_ROOT_K-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_ROOT_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SI_ROOT_K-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SI_ROOT_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_EX_BIZ-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_EX_BIZ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_ITEM_K-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_ITEM_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_PART_K-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_PART_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_ROOT_K-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_ROOT_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBILLOFMATERIALITEMTP_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBILLOFMATERIALITEMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBILLOFMATERIALITEMWD_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBILLOFMATERIALITEMWD_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTAXINVCBINDGHDRTP_DR-ISDELETED table field - China Tax Invoice Binding Deleted
▼
Description: China Tax Invoice Binding Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_BND_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTAXINVCBINDGHDRTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTAXINVCBINDGITMTP_DR-ISDELETED table field - China Tax Invoice Binding Deleted
▼
Description: China Tax Invoice Binding Deleted Field Name: ISDELETED Data Element: FICNTAXINVC_BND_DELE_FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTAXINVCBINDGITMTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPPLANDPNDANTCHARCTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANDPNDANTCHARCTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPPLANOPERATIONTP_DR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANOPERATIONTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFACTIVITYTP_D-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFACTIVITYTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFICATIONTP_DR-ISDELETED table field - Object is deleted
▼
Description: Object is deleted Field Name: ISDELETED Data Element: EAM_IS_DELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMFGWORKINSTRUCTIONTP_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGWORKINSTRUCTIONTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODALLOCSQNCCSTRTTP_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCSQNCCSTRTTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODALLOCSQNCCSTRTWD_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCSQNCCSTRTWD_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODALLOCSQNCGROUPTP_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCSQNCGROUPTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODALLOCSQNCGROUPWD_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCSQNCGROUPWD_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODNRTGVERSWRKFLWTP_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODNRTGVERSWRKFLWTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCTRACCOUNTASSGNT_WD-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRACCOUNTASSGNT_WD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURORDACCTASSIGNMENTTP-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURORDACCTASSIGNMENTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISQUALITYINPROCUREMENTTP-ISDELETED table field - Deletion Flag
▼
Description: Deletion Flag Field Name: ISDELETED Data Element: QLOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYINPROCUREMENTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSERVICEENTRYSHEETTP_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSERVICEENTRYSHEETTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSESACCOUNTASSIGNMENTTP-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSESACCOUNTASSIGNMENTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSOURCINGSUPPLIERLISTTP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSOURCINGSUPPLIERLISTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_CENTRAL_PURCHASING-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_CENTRAL_PURCHASING-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_PREQUISITION_ITEMX-ISDELETED table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: ISDELETED Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PREQUISITION_ITEMX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ITEM_BOPF_EXTX-ISDELETED table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: ISDELETED Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ITEM_BOPF_EXTX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_DISTR_LINEX-ISDELETED table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: ISDELETED Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_DISTR_LINEX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_EXTR_PR_DATA_HUB-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXTR_PR_DATA_HUB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_ITEM_ACCOUNT_INT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_ITEM_ACCOUNT_INT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_LCL_PO_ITEM_ACCT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_LCL_PO_ITEM_ACCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SRCSL_HEADERF_EX-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SRCSL_HEADERF_EX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SRCSL_MATGRPF_EX-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SRCSL_MATGRPF_EX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SUPLRL_CCODEF_EX-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SUPLRL_CCODEF_EX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSOS_S_INFORECORDDETAIL-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSOS_S_INFORECORDDETAIL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NGCS_CLASSIFICATION_DATA-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NGCS_CLASSIFICATION_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TSPURCHASEREQNACCTASSGMT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNACCTASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_CI_TRG_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_CI_TRG_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_PO_TRG_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_TRG_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SI_TRG_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SI_TRG_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_BIZ_INT-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_BIZ_INT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_CTR_INT-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_CTR_INT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_SLN_INT-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_SLN_INT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_TRG_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_TRG_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBILLOFMATERIALITEMTP_DR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBILLOFMATERIALITEMTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTRLPURCONTRHDRDISTRTP-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURCONTRHDRDISTRTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTENANCETASKLISTTP_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTENANCETASKLISTTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFACTIVITYTP_DR-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFACTIVITYTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFICATIONITEMTP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONITEMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFICATIONTASKTP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONTASKTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTORDERCOMPONENTTP_D-ISDELETED table field - Item is deleted
▼
Description: Item is deleted Field Name: ISDELETED Data Element: XLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDERCOMPONENTTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTORDEROPERATIONTP_D-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDEROPERATIONTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMFGACTIONREASONCODETP_D-ISDELETED table field - Data Record Was Deleted
▼
Description: Data Record Was Deleted Field Name: ISDELETED Data Element: QGEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGACTIONREASONCODETP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMFGWORKINSTRUCTIONTP_DR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGWORKINSTRUCTIONTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODALLOCSQNCASSGMTTP_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCSQNCASSGMTTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODALLOCSQNCCSTRTTP_DR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCSQNCCSTRTTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODALLOCSQNCCSTRTWD2_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCSQNCCSTRTWD2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODALLOCSQNCGROUPTP_DR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCSQNCGROUPTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODALLOCSQNCGROUPWD2_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCSQNCGROUPWD2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODNRTGVERSWRKFLWTP_DR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODNRTGVERSWRKFLWTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSCHEDAGRMTACCTWITHDRAFT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHEDAGRMTACCTWITHDRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSERVICEENTRYSHEETITEMTP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSERVICEENTRYSHEETITEMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_HEADER_BOPF_EXT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_HEADER_BOPF_EXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_API_HDRDISTR-ISDELETED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: ISDELETED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_HDRDISTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_API_ITMDISTR-ISDELETED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: ISDELETED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_ITMDISTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_DISTRIBUTION-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_DISTRIBUTION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_DISTRIBUTION-ISDELETED table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: ISDELETED Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_DISTRIBUTION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_DISTR_CHANGE-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_DISTR_CHANGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_COMMODITY_WEIGHTS-ISDELETED table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: ISDELETED Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_COMMODITY_WEIGHTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_EXTR_LOCALPR_DATA-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXTR_LOCALPR_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SUPLRL_HEADERF_EX-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SUPLRL_HEADERF_EX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SUPLRL_MATGRPF_EX-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SUPLRL_MATGRPF_EX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSSUPLREVALUSRDFNDCRITERIA-ISDELETED table field - Indicates if the field can be deleted or not
▼
Description: Indicates if the field can be deleted or not Field Name: ISDELETED Data Element: MMPUR_ANA_USRCRT_DELETE_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_USRCRT_DELETE_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSSUPLREVALUSRDFNDCRITERIA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_CI_ROOT_INT-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_CI_ROOT_INT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_PO_EX_ACCAS-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_ACCAS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_PO_ROOT_INT-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_ROOT_INT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SI_ROOT_INT-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SI_ROOT_INT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_ITEM_INT-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_ITEM_INT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_PART_INT-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_PART_INT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_ROOT_INT-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_ROOT_INT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPPLANDPNDANTCHARCTP_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANDPNDANTCHARCTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPPLANMATERIALASSGMTTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANMATERIALASSGMTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFICATIONCAUSETP-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONCAUSETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTORDERCOMPONENTTP_DR-ISDELETED table field - Item is deleted
▼
Description: Item is deleted Field Name: ISDELETED Data Element: XLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDERCOMPONENTTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTORDEROPERATIONTP_DR-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDEROPERATIONTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTORDERSUBOPERATIONTP-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDERSUBOPERATIONTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTTASKLISTOPERATIONTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTTASKLISTOPERATIONTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMFGACTIONREASONCODETP_DR-ISDELETED table field - Data Record Was Deleted
▼
Description: Data Record Was Deleted Field Name: ISDELETED Data Element: QGEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGACTIONREASONCODETP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODALLOCSQNCASSGMTTP_DR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCSQNCASSGMTTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCTRACCOUNTASSGNT_WD_D-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRACCOUNTASSGNT_WD_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURGINFORECORDWWITHDRAFT-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURGINFORECORDWWITHDRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURORDACCTASSIGNMENTTP_D-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURORDACCTASSIGNMENTTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISQUALITYINPROCUREMENTTP_D-ISDELETED table field - Deletion Flag
▼
Description: Deletion Flag Field Name: ISDELETED Data Element: QLOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYINPROCUREMENTTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSESACCOUNTASSIGNMENTTP_D-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSESACCOUNTASSIGNMENTTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSOURCINGSUPPLIERLISTTP_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSOURCINGSUPPLIERLISTTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSRCGSUPLRLISTMATLGROUPTP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSRCGSUPLRLISTMATLGROUPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OUTLINE_AGMT_ACCOUNT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLINE_AGMT_ACCOUNT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_PPR_S_PRITEM_DETAILS-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PPR_S_PRITEM_DETAILS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ACCASS_BOPF_EXTX-ISDELETED table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: ISDELETED Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ACCASS_BOPF_EXTX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CNTRLPURCONTR_ITEM-ISDELETED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: ISDELETED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CNTRLPURCONTR_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CTR_ITM_ACC_CHANGE-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CTR_ITM_ACC_CHANGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SRCGSLIST_BUPA_WFL-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SRCGSLIST_BUPA_WFL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSES_CHANGE_FROM_EXTERNAL-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSES_CHANGE_FROM_EXTERNAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMSES_CHANGE_FROM_EXTERNAL-ISDELETED table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: ISDELETED Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSES_CHANGE_FROM_EXTERNAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TSPURCHASEREQNACCTASSGMT_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNACCTASSGMT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_CI_EX_HEADER-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_CI_EX_HEADER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_PO_EX_HEADER-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_HEADER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SI_EX_HEADER-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SI_EX_HEADER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_EX_HEADER-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_EX_HEADER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTRLPURCONTRHDRDISTRTP_D-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURCONTRHDRDISTRTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTRLPURORDERACCTASSGMTTP-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURORDERACCTASSGMTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPPLANDPNDANTCHARCTP_DR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANDPNDANTCHARCTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFICATIONITEMTP_D-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONITEMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFICATIONTASKTP_D-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONTASKTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURORDACCTASSIGNMENTTP_DR-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURORDACCTASSIGNMENTTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMTP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMTP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISQUALITYINPROCUREMENTTP_DR-ISDELETED table field - Deletion Flag
▼
Description: Deletion Flag Field Name: ISDELETED Data Element: QLOEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYINPROCUREMENTTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSCHEDAGRMTACCTWITHDRAFT_D-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHEDAGRMTACCTWITHDRAFT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSERVICEENTRYSHEETITEMTP_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSERVICEENTRYSHEETITEMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSESACCOUNTASSIGNMENTTP_DR-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSESACCOUNTASSIGNMENTTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSOURCINGSUPPLIERLISTTP_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSOURCINGSUPPLIERLISTTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSRCGSUPLRLISTBUSPARTNERTP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSRCGSUPLRLISTBUSPARTNERTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OCI_ITM_TO_DRAFT_ITEM-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OCI_ITM_TO_DRAFT_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OUTLINE_AGMT_ACCOUNTX-ISDELETED table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: ISDELETED Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLINE_AGMT_ACCOUNTX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ACCT_ASS_BOPF_EXT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ACCT_ASS_BOPF_EXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ACCT_BOPF_EXT_OUT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ACCT_BOPF_EXT_OUT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ITEM_BOPF_EXT_CHG-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ITEM_BOPF_EXT_CHG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ITEM_BOPF_EXT_MAX-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ITEM_BOPF_EXT_MAX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ITEM_BOPF_EXT_OUT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ITEM_BOPF_EXT_OUT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_ACC_ASSIGNMENT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_ACC_ASSIGNMENT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_API_ITM_MODIFY-ISDELETED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: ISDELETED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_ITM_MODIFY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_CMMDTY_WEIGHTS-ISDELETED table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: ISDELETED Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_CMMDTY_WEIGHTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_COMMODITY_WEIGHTS_X-ISDELETED table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: ISDELETED Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_COMMODITY_WEIGHTS_X table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_EXT_LCL_PO_ITEM_ACC-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_LCL_PO_ITEM_ACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_OA_COMMODITY_WEIGHT-ISDELETED table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: ISDELETED Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_OA_COMMODITY_WEIGHT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_OA_COMMODITY_WEIGHT-ISDELETED table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: ISDELETED Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_OA_COMMODITY_WEIGHT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SSP_REQ_ITEM_CHANGE-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_REQ_ITEM_CHANGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SUPLRL_BUPAPROPF_EX-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SUPLRL_BUPAPROPF_EX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SUPLRL_HDR_AFC_BADI-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SUPLRL_HDR_AFC_BADI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TSPURCHASEREQNACCTASSGMT_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNACCTASSGMT_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSSUPLREVALUSRDFNDCRITERIA_D-ISDELETED table field - Indicates if the field can be deleted or not
▼
Description: Indicates if the field can be deleted or not Field Name: ISDELETED Data Element: MMPUR_ANA_USRCRT_DELETE_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_USRCRT_DELETE_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSSUPLREVALUSRDFNDCRITERIA_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_CI_EX_SRC_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_CI_EX_SRC_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_PO_EX_ACCAS_K-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_ACCAS_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_PO_EX_SRC_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_SRC_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SI_EX_SRC_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SI_EX_SRC_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_EX_SRC_AIF-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_EX_SRC_AIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTRLPURCONTRHDRDISTRTP_DR-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURCONTRHDRDISTRTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDEFECT_TP_Q_SEL_BY_ROOT_EL-ISDELETED table field - Is Deleted
▼
Description: Is Deleted Field Name: ISDELETED Data Element: VDM_QDEFISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEFECT_TP_Q_SEL_BY_ROOT_EL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPPLANMATERIALASSGMTTP_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANMATERIALASSGMTTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFICATIONCAUSETP_D-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONCAUSETP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFICATIONITEMTP_DR-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONITEMTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFICATIONTASKTP_DR-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONTASKTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTORDERSUBOPERATIONTP_D-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDERSUBOPERATIONTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTTASKLISTOPERATIONTP_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTTASKLISTOPERATIONTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPHYSINVTRYVOLMASSRDNGTP_DR-ISDELETED table field - Deletion indicator
▼
Description: Deletion indicator Field Name: ISDELETED Data Element: OII_DELIND Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPHYSINVTRYVOLMASSRDNGTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCHASEREQUISITIONITEM_WD-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEREQUISITIONITEM_WD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURGINFORECORDWWITHDRAFT_D-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURGINFORECORDWWITHDRAFT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMTP1-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMTP2-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMTP1-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSCHEDAGRMTACCTWITHDRAFT_DR-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHEDAGRMTACCTWITHDRAFT_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSERVICEENTRYSHEETITEMTP_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSERVICEENTRYSHEETITEMTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSRCGSUPLRLISTCOMPANYCODETP-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSRCGSUPLRLISTCOMPANYCODETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSRCGSUPLRLISTMATLGROUPTP_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSRCGSUPLRLISTMATLGROUPTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPLREVALUSRDFNDCRITERIATP-ISDELETED table field - Indicates if the field can be deleted or not
▼
Description: Indicates if the field can be deleted or not Field Name: ISDELETED Data Element: MMPUR_ANA_USRCRT_DELETE_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_USRCRT_DELETE_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLREVALUSRDFNDCRITERIATP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPPLIERLISTCOMPANYCODETP1-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPPLIERLISTCOMPANYCODETP1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_PREQUISITION_ACCTASGMT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PREQUISITION_ACCTASGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_REQ_BE_EOP_DELETE_SYNC-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_REQ_BE_EOP_DELETE_SYNC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ITEM_BOPF_EXTX_MAX-ISDELETED table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: ISDELETED Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ITEM_BOPF_EXTX_MAX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_API_COMM_WEIGHT-ISDELETED table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: ISDELETED Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_COMM_WEIGHT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_API_ITEM_MODIFY-ISDELETED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: ISDELETED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_ITEM_MODIFY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NGCS_CLASSIFICATION_DATA_UPD-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NGCS_CLASSIFICATION_DATA_UPD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSSUPLREVALUSRDFNDCRITERIA_DR-ISDELETED table field - Indicates if the field can be deleted or not
▼
Description: Indicates if the field can be deleted or not Field Name: ISDELETED Data Element: MMPUR_ANA_USRCRT_DELETE_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_USRCRT_DELETE_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSSUPLREVALUSRDFNDCRITERIA_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCS_DPR_ORG_DEFAULT_PERSON-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: EHPRC_IMDS_DEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: EHPRC_IMDS_DEL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCS_DPR_ORG_DEFAULT_PERSON table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_CI_EX_HEADER_K-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_CI_EX_HEADER_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_PO_EX_ACCAS_DB-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_ACCAS_DB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_PO_EX_HEADER_K-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_HEADER_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SI_EX_HEADER_K-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SI_EX_HEADER_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_EX_HEADER_K-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_EX_HEADER_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISALLOCCHARCCTLGAUTHZNGROUPTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISALLOCCHARCCTLGAUTHZNGROUPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISALLOCCHARCCTLGAUTHZNVALUETP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISALLOCCHARCCTLGAUTHZNVALUETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTRLPURCONTRDISTRIBUTIONTP-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURCONTRDISTRIBUTIONTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTRLPURORDERACCTASSGMTTP_D-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURORDERACCTASSGMTTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPPLANMATERIALASSGMTTP_DR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANMATERIALASSGMTTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFICATIONCAUSETP_DR-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: KZLOESCH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONCAUSETP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTORDERSUBOPERATIONTP_DR-ISDELETED table field -
▼
Description: Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDERSUBOPERATIONTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMFGWORKINSTRUCTIONVERSIONTP-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGWORKINSTRUCTIONVERSIONTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURGINFORECORDWWITHDRAFT_DR-ISDELETED table field - Purchasing info: General data flagged for deletion
▼
Description: Purchasing info: General data flagged for deletion Field Name: ISDELETED Data Element: ILOEA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURGINFORECORDWWITHDRAFT_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMTP_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMTP_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSRCGSUPLRLISTBUSPARTNERTP_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSRCGSUPLRLISTBUSPARTNERTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSRCGSUPLRLISTMATLGROUPTP_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSRCGSUPLRLISTMATLGROUPTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPLREVALUSRDFNDCRITERIATP1-ISDELETED table field - Indicates if the field can be deleted or not
▼
Description: Indicates if the field can be deleted or not Field Name: ISDELETED Data Element: MMPUR_ANA_USRCRT_DELETE_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_USRCRT_DELETE_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLREVALUSRDFNDCRITERIATP1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPLRLISTBUSINESSPARTNERTP2-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLRLISTBUSINESSPARTNERTP2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPLRLISTPROPOSEDSUPPLIERTP-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLRLISTPROPOSEDSUPPLIERTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPPLIERLISTMATERIALGROUPTP-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPPLIERLISTMATERIALGROUPTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_HEADER_BOPF_EXT_MAX-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_HEADER_BOPF_EXT_MAX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_HEADER_BOPF_EXT_OUT-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_HEADER_BOPF_EXT_OUT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_API_HDRDISTR_MOD-ISDELETED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: ISDELETED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_HDRDISTR_MOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_API_ITMDISTR_MOD-ISDELETED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: ISDELETED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_ITMDISTR_MOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PR_ODATA_ACCNT_ASSIGN-ISDELETED table field - Character field of length 6
▼
Description: Character field of length 6 Field Name: ISDELETED Data Element: CHAR6 Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: CHAR6 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_ODATA_ACCNT_ASSIGN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PURORDACCOUNTASSIGNMT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PURORDACCOUNTASSIGNMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NGCS_CORE_CLASSIFICATION_DATA-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NGCS_CORE_CLASSIFICATION_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPWF/ISQUALITYTASKTP______00-ISDELETED table field - Delete Data Record
▼
Description: Delete Data Record Field Name: ISDELETED Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPWF/ISQUALITYTASKTP______00 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_CI_EX_HEADER_DB-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_CI_EX_HEADER_DB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_PO_EX_HEADER_DB-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_HEADER_DB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SI_EX_HEADER_DB-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SI_EX_HEADER_DB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_SO_EX_HEADER_DB-ISDELETED table field - Logically Deleted
▼
Description: Logically Deleted Field Name: ISDELETED Data Element: FINS_CFIN_AV_ISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_EX_HEADER_DB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISALLOCCHARCCTLGAUTHZNGROUPT_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISALLOCCHARCCTLGAUTHZNGROUPT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISALLOCCHARCCTLGAUTHZNGROUP_DR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISALLOCCHARCCTLGAUTHZNGROUP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISALLOCCHARCCTLGAUTHZNVALUET_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISALLOCCHARCCTLGAUTHZNVALUET_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISALLOCCHARCCTLGAUTHZNVALUE_DR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISALLOCCHARCCTLGAUTHZNVALUE_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCENTRALRFQITEMDISTRIBUTIONTP-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALRFQITEMDISTRIBUTIONTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCENTRALRFQITEMDISTRIBUTION_D-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALRFQITEMDISTRIBUTION_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCENTRALRFQITEMDISTRIBUTIO_DR-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALRFQITEMDISTRIBUTIO_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTRLPURCONTRDISTRIBUTIONT_D-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURCONTRDISTRIBUTIONT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTRLPURCONTRDISTRIBUTION_DR-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURCONTRDISTRIBUTION_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTRLPURORDERACCTASSGMTTP_DR-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURORDERACCTASSGMTTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTRLSUPPLIERQTANITEMDISTRTP-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLSUPPLIERQTANITEMDISTRTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTRLSUPPLIERQTANITEMDISTR_D-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLSUPPLIERQTANITEMDISTR_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTRLSUPPLIERQTANITEMDIST_DR-ISDELETED table field - Link field for view query
▼
Description: Link field for view query Field Name: ISDELETED Data Element: BOOL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: BOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLSUPPLIERQTANITEMDIST_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMFGWORKINSTRUCTIONVERSIONT_D-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGWORKINSTRUCTIONVERSIONT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMFGWORKINSTRUCTIONVERSION_DR-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGWORKINSTRUCTIONVERSION_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCHASEREQUISITIONITEM_WD_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEREQUISITIONITEM_WD_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCHASEREQUISITIONITEM_W_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEREQUISITIONITEM_W_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMT1_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMT1_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMT2_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMT2_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMTP1_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP1_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMTP2_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMTP_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMT1_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMT1_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMT2_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMT2_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMT3_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMT3_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMT4_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMT4_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMTP1_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP1_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMTP2_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMTP3_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP3_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMTP4_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP4_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMTP_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSRCGSUPLRLISTBUSPARTNERTP_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSRCGSUPLRLISTBUSPARTNERTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSRCGSUPLRLISTCOMPANYCODETP_D-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSRCGSUPLRLISTCOMPANYCODETP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSRCGSUPLRLISTCOMPANYCODET_DR-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSRCGSUPLRLISTCOMPANYCODET_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPLREVALUSRDFNDCRITERIAT1_D-ISDELETED table field - Indicates if the field can be deleted or not
▼
Description: Indicates if the field can be deleted or not Field Name: ISDELETED Data Element: MMPUR_ANA_USRCRT_DELETE_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_USRCRT_DELETE_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLREVALUSRDFNDCRITERIAT1_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPLREVALUSRDFNDCRITERIATP_D-ISDELETED table field - Indicates if the field can be deleted or not
▼
Description: Indicates if the field can be deleted or not Field Name: ISDELETED Data Element: MMPUR_ANA_USRCRT_DELETE_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_USRCRT_DELETE_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLREVALUSRDFNDCRITERIATP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPLREVALUSRDFNDCRITERIAT_DR-ISDELETED table field - Indicates if the field can be deleted or not
▼
Description: Indicates if the field can be deleted or not Field Name: ISDELETED Data Element: MMPUR_ANA_USRCRT_DELETE_FLG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_USRCRT_DELETE_FLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLREVALUSRDFNDCRITERIAT_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPLRLISTBUSINESSPARTNER2_DR-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLRLISTBUSINESSPARTNER2_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPLRLISTBUSINESSPARTNERT2_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLRLISTBUSINESSPARTNERT2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPLRLISTPROPOSEDSUPPLIERT_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLRLISTPROPOSEDSUPPLIERT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPLRLISTPROPOSEDSUPPLIER_DR-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLRLISTPROPOSEDSUPPLIER_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPPLIERLISTCOMPANYCODET1_DR-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPPLIERLISTCOMPANYCODET1_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPPLIERLISTCOMPANYCODETP1_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPPLIERLISTCOMPANYCODETP1_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPPLIERLISTMATERIALGROUPT_D-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPPLIERLISTMATERIALGROUPT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUPPLIERLISTMATERIALGROUP_DR-ISDELETED table field - Is Deleted Indicator
▼
Description: Is Deleted Indicator Field Name: ISDELETED Data Element: VDM_SUPLRLISTISDELETED Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPPLIERLISTMATERIALGROUP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_PR_APRVL_CMPL_S_ACCLINES-ISDELETED table field - Deletion indicator in purchasing document
▼
Description: Deletion indicator in purchasing document Field Name: ISDELETED Data Element: ELOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ELOEK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PR_APRVL_CMPL_S_ACCLINES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_HEADER_BOPF_EXTX_MAX-ISDELETED table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: ISDELETED Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_HEADER_BOPF_EXTX_MAX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_API_HDRDIS_MODIFY-ISDELETED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: ISDELETED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_HDRDIS_MODIFY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_API_ITMDIS_MODIFY-ISDELETED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: ISDELETED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_ITMDIS_MODIFY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CNTRLPURCONTR_HDRDISTR-ISDELETED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: ISDELETED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CNTRLPURCONTR_HDRDISTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CNTRLPURCONTR_ITMDISTR-ISDELETED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: ISDELETED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CNTRLPURCONTR_ITMDISTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CTR_ACCASSIGNMT_IMPORT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CTR_ACCASSIGNMT_IMPORT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PR_ACCTASSIGNMT_IMPORT-ISDELETED table field - Deletion Indicator: Purchasing Document Account Assignment
▼
Description: Deletion Indicator: Purchasing Document Account Assignment Field Name: ISDELETED Data Element: KLOEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_ACCTASSIGNMT_IMPORT table
|