Details |
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IVCSIM-LASTCHANGETIME table field - Simulation: Changed On Time
▼
Description: Simulation: Changed On Time Field Name: LASTCHANGETIME Data Element: VCHCLF_SIM_CHANGED_ON_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVCSIM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FACV_FH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FACV_FH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPIRHIST-LASTCHANGETIME table field - Time
▼
Description: Time Field Name: LASTCHANGETIME Data Element: UZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPIRHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPIRHIST-LASTCHANGETIME table field -
▼
Description: Field Name: LASTCHANGETIME Data Element: Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPIRHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IEMPLOYEE-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEMPLOYEE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAKEBTTP-LASTCHANGETIME table field - Creation Time
▼
Description: Creation Time Field Name: LASTCHANGETIME Data Element: TTET_DT_CR_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TTE_DT_TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAKEBTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PITEMCOMM-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: WLF_AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PITEMCOMM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPIRHIST0-LASTCHANGETIME table field - Time
▼
Description: Time Field Name: LASTCHANGETIME Data Element: UZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPIRHIST0 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSAVEDSIM-LASTCHANGETIME table field - Simulation: Changed On Time
▼
Description: Simulation: Changed On Time Field Name: LASTCHANGETIME Data Element: VCHCLF_SIM_CHANGED_ON_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSAVEDSIM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PWPIRHIST-LASTCHANGETIME table field -
▼
Description: Field Name: LASTCHANGETIME Data Element: Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PWPIRHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFPROGOBJP-LASTCHANGETIME table field - Funded Program Changed at Time
▼
Description: Funded Program Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FP_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFPROGOBJP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CGRANTOBJP-LASTCHANGETIME table field - Last Modified Time
▼
Description: Last Modified Time Field Name: LASTCHANGETIME Data Element: GM_LAST_MODIFIED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: GM_CREATED_AT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRANTOBJP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICABUSLOCK-LASTCHANGETIME table field - Time
▼
Description: Time Field Name: LASTCHANGETIME Data Element: UZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABUSLOCK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDDPIRHIST-LASTCHANGETIME table field - Time
▼
Description: Time Field Name: LASTCHANGETIME Data Element: UZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDDPIRHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRODUCTWD-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRODUCTWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IREVIEWLOG-LASTCHANGETIME table field - Field of type TIMS
▼
Description: Field of type TIMS Field Name: LASTCHANGETIME Data Element: TIMS Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREVIEWLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCONFOWNSIM-LASTCHANGETIME table field - Simulation: Changed On Time
▼
Description: Simulation: Changed On Time Field Name: LASTCHANGETIME Data Element: VCHCLF_SIM_CHANGED_ON_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCONFOWNSIM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBANKCONDTP-LASTCHANGETIME table field - Time Changed
▼
Description: Time Changed Field Name: LASTCHANGETIME Data Element: BKK_CHTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBANKCONDTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIGLACCHER-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLACCHER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFISEGMENTH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFISEGMENTH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPIRHISTBSC-LASTCHANGETIME table field - Time
▼
Description: Time Field Name: LASTCHANGETIME Data Element: UZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPIRHISTBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCONFOWNSIM-LASTCHANGETIME table field - Simulation: Changed On Time
▼
Description: Simulation: Changed On Time Field Name: LASTCHANGETIME Data Element: VCHCLF_SIM_CHANGED_ON_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCONFOWNSIM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PEMPLOYEECL-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEMPLOYEECL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSIMULATION-LASTCHANGETIME table field - Simulation: Changed On Time
▼
Description: Simulation: Changed On Time Field Name: LASTCHANGETIME Data Element: VCHCLF_SIM_CHANGED_ON_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIMULATION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PTEXTOBJECT-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: TDLTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PTEXTOBJECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ALLOCCYCLETP-LASTCHANGETIME table field - Hash Value (160 Bits)
▼
Description: Hash Value (160 Bits) Field Name: LASTCHANGETIME Data Element: HASH160 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ALLOCCYCLETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBUPASUPLIER-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBUPASUPLIER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIFINSTATEH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIFINSTATEH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIFUNCAREAH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIFUNCAREAH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROCBUSUSER-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROCBUSUSER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIBAKACCTH2-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIBAKACCTH2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBUPACUSTOMER-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBUPACUSTOMER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFMFUNCAREATP-LASTCHANGETIME table field - Functional Area Changed at Time
▼
Description: Functional Area Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FAREA_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFMFUNCAREATP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CGLITEMCHGLOG-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGLITEMCHGLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMFGORDDEFREC-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMFGORDDEFREC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSETFUNDEDGRP-LASTCHANGETIME table field - Funded Program Changed at Time
▼
Description: Funded Program Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FP_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSETFUNDEDGRP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CVARCONFSIMTP-LASTCHANGETIME table field - Simulation: Changed On Time
▼
Description: Simulation: Changed On Time Field Name: LASTCHANGETIME Data Element: VCHCLF_SIM_CHANGED_ON_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CVARCONFSIMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IABPPAYBTCHTP-LASTCHANGETIME table field - Hash Value (160 Bits)
▼
Description: Hash Value (160 Bits) Field Name: LASTCHANGETIME Data Element: HASH160 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IABPPAYBTCHTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIGLACCOUNTH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLACCOUNTH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFMFUNCAREATP-LASTCHANGETIME table field - Functional Area Changed at Time
▼
Description: Functional Area Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FAREA_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMFUNCAREATP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFUNDEDPROGTP-LASTCHANGETIME table field - Funded Program Changed at Time
▼
Description: Funded Program Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FP_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFUNDEDPROGTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMNTORDTOCUBE-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMNTORDTOCUBE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IVARCONFSIMTP-LASTCHANGETIME table field - Simulation: Changed On Time
▼
Description: Simulation: Changed On Time Field Name: LASTCHANGETIME Data Element: VCHCLF_SIM_CHANGED_ON_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVARCONFSIMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IVARCONFSIMVH-LASTCHANGETIME table field - Simulation: Changed On Time
▼
Description: Simulation: Changed On Time Field Name: LASTCHANGETIME Data Element: VCHCLF_SIM_CHANGED_ON_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVARCONFSIMVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PNOTIFPARTNER-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNOTIFPARTNER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPIRDAILYHIST-LASTCHANGETIME table field -
▼
Description: Field Name: LASTCHANGETIME Data Element: Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPIRDAILYHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPROJNTWKVERS-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJNTWKVERS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBUDGETDOCOBJP-LASTCHANGETIME table field - Time at which the object was changed
▼
Description: Time at which the object was changed Field Name: LASTCHANGETIME Data Element: BUKU_CHGTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBUDGETDOCOBJP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CINSPSUBRESREC-LASTCHANGETIME table field - System Time at Which Data Record Was Changed
▼
Description: System Time at Which Data Record Was Changed Field Name: LASTCHANGETIME Data Element: VDM_QZEITAEND Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPSUBRESREC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMANPRODNORDER-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMANPRODNORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMDQPRODDETAIL-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDQPRODDETAIL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMNTORDTOQUERY-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMNTORDTOQUERY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBANKACCOUNTTP-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBANKACCOUNTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFICOSTCENTERH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFICOSTCENTERH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IJOURNALENTHST-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IJOURNALENTHST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFCSTDMNDIHIST-LASTCHANGETIME table field - Time
▼
Description: Time Field Name: LASTCHANGETIME Data Element: UZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFCSTDMNDIHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PJOURNALENTHST-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PJOURNALENTHST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMNTHLYPIRHIST-LASTCHANGETIME table field -
▼
Description: Field Name: LASTCHANGETIME Data Element: Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMNTHLYPIRHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPIRHISTBYDATE-LASTCHANGETIME table field -
▼
Description: Field Name: LASTCHANGETIME Data Element: Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPIRHISTBYDATE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PWPIRHISTBYDTE-LASTCHANGETIME table field -
▼
Description: Field Name: LASTCHANGETIME Data Element: Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PWPIRHISTBYDTE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFMFUNCAREAOBJP-LASTCHANGETIME table field - Functional Area Changed at Time
▼
Description: Functional Area Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FAREA_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFMFUNCAREAOBJP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIBANKACCOUNTH-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIBANKACCOUNTH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIBANKACCOUNTH-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIBANKACCOUNTH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
POUTFRMGENATT03-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POUTFRMGENATT03 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
POUTFRMGENATT04-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POUTFRMGENATT04 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PLMI/C_ER_CI_AN-LASTCHANGETIME table field - Change Time for Change Item
▼
Description: Change Time for Change Item Field Name: LASTCHANGETIME Data Element: /PLMI/S_ECR_CI_MOD_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/C_ER_CI_AN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBANKACCTWITHREV-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBANKACCTWITHREV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIINTORDERQ0001-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIINTORDERQ0001 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMDQLTYPRODBDRES-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDQLTYPRODBDRES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMDQLTYPRODSARES-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDQLTYPRODSARES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSETLEAFGRANTGRP-LASTCHANGETIME table field - Last Modified Time
▼
Description: Last Modified Time Field Name: LASTCHANGETIME Data Element: GM_LAST_MODIFIED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: GM_CREATED_AT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSETLEAFGRANTGRP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICABPBUSLOCKHIST-LASTCHANGETIME table field - Time
▼
Description: Time Field Name: LASTCHANGETIME Data Element: UZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABPBUSLOCKHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IECCACCTINLCKRSN-LASTCHANGETIME table field - Time
▼
Description: Time Field Name: LASTCHANGETIME Data Element: UZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IECCACCTINLCKRSN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIPROFITCENTERH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIPROFITCENTERH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFMFUNCNLACORETP-LASTCHANGETIME table field - Functional Area Changed at Time
▼
Description: Functional Area Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FAREA_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMFUNCNLACORETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPFCSTDMNDIHIST-LASTCHANGETIME table field - Time
▼
Description: Time Field Name: LASTCHANGETIME Data Element: UZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPFCSTDMNDIHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROJNETWITHVERS-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJNETWITHVERS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCABUSLOCKVLDTDY-LASTCHANGETIME table field - Time
▼
Description: Time Field Name: LASTCHANGETIME Data Element: UZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCABUSLOCKVLDTDY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PDYMNTHWKPIRHIST-LASTCHANGETIME table field -
▼
Description: Field Name: LASTCHANGETIME Data Element: Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDYMNTHWKPIRHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMNTHLYHISTBYDTE-LASTCHANGETIME table field -
▼
Description: Field Name: LASTCHANGETIME Data Element: Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMNTHLYHISTBYDTE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBRNFS-LASTCHANGETIME table field - Time when the document was last changed
▼
Description: Time when the document was last changed Field Name: LASTCHANGETIME Data Element: LOGBR_CHATIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBRNFS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMDQBP-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDQBP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFUNDH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFUNDH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSTX_D-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSTX_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ADEFECT-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ADEFECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDEFREC-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFREC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBUPATP-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBUPATP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAMDID-LASTCHANGETIME table field - Last changed at
▼
Description: Last changed at Field Name: LASTCHANGETIME Data Element: AS4TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: AS4TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDID table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCBAHD-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCBAHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCFAHD-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCFAHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCSGHD-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCSGHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDEFECT-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDEFECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPSTEXT-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LSTCHGAT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
QTASK_D-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QTASK_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRODUCT-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRODUCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FCLMCOND-LASTCHANGETIME table field - Time Changed
▼
Description: Time Changed Field Name: LASTCHANGETIME Data Element: BKK_CHTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCLMCOND table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBDGTPDH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBDGTPDH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBUPAREL-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBUPAREL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCFTTHD-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCFTTHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDMETREE-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMETREE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFCTRYPH-LASTCHANGETIME table field - Calendar: Creation or change time
▼
Description: Calendar: Creation or change time Field Name: LASTCHANGETIME Data Element: CRTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFCTRYPH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIBUSAH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIBUSAH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IGMGRANT-LASTCHANGETIME table field - Last Modified Time
▼
Description: Last Modified Time Field Name: LASTCHANGETIME Data Element: GM_LAST_MODIFIED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: GM_CREATED_AT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMGRANT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMDQBUPA-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMDQBUPA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPBATCH-LASTCHANGETIME table field - Change Time
▼
Description: Change Time Field Name: LASTCHANGETIME Data Element: BNK_COM_CHANGE_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPBATCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMSTRRCP-LASTCHANGETIME table field - Time of last change made to the task list
▼
Description: Time of last change made to the task list Field Name: LASTCHANGETIME Data Element: AEUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRCP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRODRTG-LASTCHANGETIME table field - Time of last change made to the task list
▼
Description: Time of last change made to the task list Field Name: LASTCHANGETIME Data Element: AEUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRODRTG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRODUCT-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRODUCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYTSK-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYTSK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCDSVIEW-LASTCHANGETIME table field - Last changed at
▼
Description: Last changed at Field Name: LASTCHANGETIME Data Element: AS4TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: AS4TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCDSVIEW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VICARG_D-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VICARG_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VICNCN_D-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VICNCN_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
AHUHDRDLV-LASTCHANGETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: LASTCHANGETIME Data Element: AEZET Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AHUHDRDLV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BANKACCWD-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BANKACCWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BSSP_S_BP-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BSSP_S_BP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBUPAREL2-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBUPAREL2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAMDIDTP-LASTCHANGETIME table field - Last changed at
▼
Description: Last changed at Field Name: LASTCHANGETIME Data Element: AS4TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: AS4TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAMDIDTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSIGNCARD-LASTCHANGETIME table field - Last Changed Time
▼
Description: Last Changed Time Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSIGNCARD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAMDIDTP-LASTCHANGETIME table field - Last changed at
▼
Description: Last changed at Field Name: LASTCHANGETIME Data Element: AS4TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: AS4TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDIDTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNDNCNTR-LASTCHANGETIME table field - Time of Last Condition Contract Change
▼
Description: Time of Last Condition Contract Change Field Name: LASTCHANGETIME Data Element: WCB_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: WCB_CHANGED_AT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNDNCNTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDEFECTTP-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDEFECTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDMECTREE-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMECTREE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDMEPRPTY-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMEPRPTY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIORDERH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIORDERH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IGMGRANTH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMGRANTH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAKEBTDF-LASTCHANGETIME table field - Creation Time
▼
Description: Creation Time Field Name: LASTCHANGETIME Data Element: TTET_DT_CR_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TTE_DT_TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAKEBTDF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGORDER-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFACT-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFITM-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFPAR-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFPAR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFTSK-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFTSK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPKANBAN-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: VDM_SAEUZ Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPKANBAN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRFMMPLND-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: FSH_CHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMPLND table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRFMMPROD-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: FSH_CHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMPROD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISIGNCARD-LASTCHANGETIME table field - Last Changed Time
▼
Description: Last Changed Time Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISIGNCARD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MPES_QMFE-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPES_QMFE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PNEMPLOYE-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNEMPLOYE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
POEMPLOYE-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POEMPLOYE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOSFLOWS-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOSFLOWS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PROD_ROOT-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PROD_ROOT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PUEMPLOYE-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PUEMPLOYE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
QDEFECT_D-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QDEFECT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RCNDNCNTR-LASTCHANGETIME table field - Time of Last Condition Contract Change
▼
Description: Time of Last Condition Contract Change Field Name: LASTCHANGETIME Data Element: WCB_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: WCB_CHANGED_AT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCNDNCNTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RIOTSITTR-LASTCHANGETIME table field - Entry time
▼
Description: Entry time Field Name: LASTCHANGETIME Data Element: ERZET Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RIOTSITTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VPKHEAD_D-LASTCHANGETIME table field - System Time
▼
Description: System Time Field Name: LASTCHANGETIME Data Element: SYUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VPKHEAD_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ALLOCCYCLE-LASTCHANGETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: LASTCHANGETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ALLOCCYCLE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
AUFK_DRAFT-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AUFK_DRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUPA_REL_D-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUPA_REL_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDEFECTFDP-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFECTFDP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDEFECTMNG-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFECTMNG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMFGORDDEF-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMFGORDDEF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPAYFRTREE-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPAYFRTREE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOSTGPERD-LASTCHANGETIME table field - Posting Period Last Change Time
▼
Description: Posting Period Last Change Time Field Name: LASTCHANGETIME Data Element: POSTINGPERIODCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOSTGPERD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CWUPCGROUP-LASTCHANGETIME table field - Time of last change
▼
Description: Time of last change Field Name: LASTCHANGETIME Data Element: UP_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: T MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWUPCGROUP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFKKRK_GFN-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: AETIM_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKRK_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFKKRP_GFN-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: AETIM_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKRP_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DMECD_TREE-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DMECD_TREE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_DZFSVH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZFSVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IACTLOGPRD-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACTLOGPRD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBPPROCESS-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPPROCESS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCGLACCHD-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCGLACCHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICMMTITEMH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMTITEMH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDEFECTUNI-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDEFECTUNI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDMECPRPTY-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMECPRPTY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFCTRYCALS-LASTCHANGETIME table field - Calendar: Creation or change time
▼
Description: Calendar: Creation or change time Field Name: LASTCHANGETIME Data Element: CRTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFCTRYCALS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFICOCODEH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFICOCODEH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFMBDGTDOC-LASTCHANGETIME table field - Time at which the object was changed
▼
Description: Time at which the object was changed Field Name: LASTCHANGETIME Data Element: BUKU_CHGTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBDGTDOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IGMSPPROGH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMSPPROGH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYTSKTP-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYTSKTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQNOTIFACT-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQNOTIFACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQNOTIFPAR-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQNOTIFPAR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQNOTIFTSK-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQNOTIFTSK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRECDCFOBJ-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRECDCFOBJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRECDCFPAY-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRECDCFPAY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IREDOCHEAD-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREDOCHEAD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISETHEADER-LASTCHANGETIME table field - Time of last change
▼
Description: Time of last change Field Name: LASTCHANGETIME Data Element: UP_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: T MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISETHEADER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MDC_BUT000-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDC_BUT000 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PESHVIEWCE-LASTCHANGETIME table field - Last changed at
▼
Description: Last changed at Field Name: LASTCHANGETIME Data Element: AS4TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: AS4TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PESHVIEWCE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSBRFMSGTP-LASTCHANGETIME table field - Time of status change
▼
Description: Time of status change Field Name: LASTCHANGETIME Data Element: CSTIM_PS Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSBRFMSGTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VFCLMBAHVH-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VFCLMBAHVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
AINSPSUBSET-LASTCHANGETIME table field - System Time at Which Data Record Was Changed
▼
Description: System Time at Which Data Record Was Changed Field Name: LASTCHANGETIME Data Element: VDM_QZEITAEND Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINSPSUBSET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ASEASONTEXT-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: FSH_CHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASEASONTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUPA_ROOT_D-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUPA_ROOT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBNKBTCHSIT-LASTCHANGETIME table field - Change Time
▼
Description: Change Time Field Name: LASTCHANGETIME Data Element: BNK_COM_CHANGE_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBNKBTCHSIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBRVERIFYNF-LASTCHANGETIME table field - Time when the document was last changed
▼
Description: Time when the document was last changed Field Name: LASTCHANGETIME Data Element: LOGBR_CHATIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBRVERIFYNF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDEFECTTFDP-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFECTTFDP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CINSPSUBSET-LASTCHANGETIME table field - System Time at Which Data Record Was Changed
▼
Description: System Time at Which Data Record Was Changed Field Name: LASTCHANGETIME Data Element: VDM_QZEITAEND Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPSUBSET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPAYFRCTREE-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPAYFRCTREE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPROJTEAMCD-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPROJTEAMCD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_L_FAREA-LASTCHANGETIME table field - Functional Area Changed at Time
▼
Description: Functional Area Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FAREA_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_FAREA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_U_FAREA-LASTCHANGETIME table field - Functional Area Changed at Time
▼
Description: Functional Area Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FAREA_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_FAREA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBANKACCTUH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBANKACCTUH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBANKACCTWR-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBANKACCTWR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBNKBTCHSIT-LASTCHANGETIME table field - Change Time
▼
Description: Change Time Field Name: LASTCHANGETIME Data Element: BNK_COM_CHANGE_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBNKBTCHSIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBUPARELTP2-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBUPARELTP2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFMFUNCAREA-LASTCHANGETIME table field - Functional Area Changed at Time
▼
Description: Functional Area Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FAREA_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMFUNCAREA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IGMSPCLASSH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMSPCLASSH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IINSPSUBSET-LASTCHANGETIME table field - System Time at Which Data Record Was Changed
▼
Description: System Time at Which Data Record Was Changed Field Name: LASTCHANGETIME Data Element: VDM_QZEITAEND Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSUBSET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTNOTIF-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTNOTIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFCAUSE-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFCAUSE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFTSKTS-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFTSKTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IORDERBASIC-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IORDERBASIC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPAYFRCTREE-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYFRCTREE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPMFGORDER-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMFGORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROJTEAMCD-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJTEAMCD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRVDRCONTR-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRVDRCONTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYNTFCAU-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNTFCAU table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYNTFITM-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNTFITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IREBUILDING-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREBUILDING table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRECONTRACT-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRECONTRACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IREPROPERTY-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREPROPERTY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDEFECT_TP-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEFECT_TP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODUCTWD-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODUCTWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRVDOCNOTE-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: TDLTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVDOCNOTE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ITEXTOBJECT-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: TDLTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITEXTOBJECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PAYRQ_DRAFT-LASTCHANGETIME table field - Change Time
▼
Description: Change Time Field Name: LASTCHANGETIME Data Element: BNK_COM_CHANGE_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYRQ_DRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PEMPLOYEEOP-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEMPLOYEEOP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PHEADERTEXT-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: TDLTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PHEADERTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PIFMEGENATT-LASTCHANGETIME table field -
▼
Description: Field Name: LASTCHANGETIME Data Element: Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PIFMEGENATT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRECONTRACT-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRECONTRACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RPRODNORDTP-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPRODNORDTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUPA_S_ORG_D-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUPA_S_ORG_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CACTLOGLPROD-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACTLOGLPROD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBRVERIFYCTE-LASTCHANGETIME table field - Time when the document was last changed
▼
Description: Time when the document was last changed Field Name: LASTCHANGETIME Data Element: LOGBR_CHATIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBRVERIFYCTE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMDQLTYBPRES-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDQLTYBPRES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPAYFRTRPROP-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPAYFRTRPROP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CQLTYTSKPROC-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYTSKPROC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMS4IUVCPRD-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4IUVCPRD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMS4IUVIPRD-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4IUVIPRD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFKKBIX_MD_D-LASTCHANGETIME table field - Last changed at
▼
Description: Last changed at Field Name: LASTCHANGETIME Data Element: AS4TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: AS4TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKBIX_MD_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FCLMCONDITEM-LASTCHANGETIME table field - Time Changed
▼
Description: Time Changed Field Name: LASTCHANGETIME Data Element: BKK_CHTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCLMCONDITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKK_VT_D_GFN-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_VT_D_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKK_VT_H_GFN-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_VT_H_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKK_VT_I_GFN-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_VT_I_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBPARTNERGOV-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPARTNERGOV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICARETURNLOT-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICARETURNLOT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCCOUNTRYHD-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCCOUNTRYHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCCUSTGRPHD-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCCUSTGRPHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCPRFTCTRHD-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCPRFTCTRHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCPRODUCTHD-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCPRODUCTHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCPROJECTHD-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCPROJECTHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCRIHIERDIR-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCRIHIERDIR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IENTPRJELMCD-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IENTPRJELMCD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFMBDGTSTRUC-LASTCHANGETIME table field - Time at which the object was changed
▼
Description: Time at which the object was changed Field Name: LASTCHANGETIME Data Element: BUKU_CHGTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBDGTSTRUC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRODMRPAREA-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRODMRPAREA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRVDRCONTRH-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRVDRCONTRH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRVDRCONTRI-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRVDRCONTRI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPSMS4CBDACH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSMS4CBDACH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IREBUSENTITY-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREBUSENTITY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRECONDITION-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRECONDITION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IREINTOBJECT-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREINTOBJECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRESETTLUNIT-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRESETTLUNIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISEASONBASIC-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: FSH_CHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISEASONBASIC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTNOTIF_D-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTNOTIF_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTNTFTO_D-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTNTFTO_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCDSVIEWATTR-LASTCHANGETIME table field - Last changed at
▼
Description: Last changed at Field Name: LASTCHANGETIME Data Element: AS4TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: AS4TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCDSVIEWATTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PNEMPLOYEEOP-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNEMPLOYEEOP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PNOTIFSEARCH-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNOTIFSEARCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
POEMPLOYEEOP-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POEMPLOYEEOP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PUEMPLOYEEOP-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PUEMPLOYEEOP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PWUIOGRPHIER-LASTCHANGETIME table field - Time of last change
▼
Description: Time of last change Field Name: LASTCHANGETIME Data Element: UP_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: T MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PWUIOGRPHIER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RECP_CLERK_C-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_CLERK_C table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VICARSDATE_D-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VICARSDATE_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VIIPOBJECT_D-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIIPOBJECT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VQAPP_ACTIVE-LASTCHANGETIME table field - System Time at Which Data Record Was Changed
▼
Description: System Time at Which Data Record Was Changed Field Name: LASTCHANGETIME Data Element: QZEITAEND Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VQAPP_ACTIVE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
V_DEF_BO2ACT-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_DEF_BO2ACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ABRNFDOCUMENT-LASTCHANGETIME table field - Time when the document was last changed
▼
Description: Time when the document was last changed Field Name: LASTCHANGETIME Data Element: LOGBR_CHATIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ABRNFDOCUMENT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ALLOCCYCLETPD-LASTCHANGETIME table field - Hash Value (160 Bits)
▼
Description: Hash Value (160 Bits) Field Name: LASTCHANGETIME Data Element: HASH160 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ALLOCCYCLETPD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ASEASONMASTER-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: FSH_CHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASEASONMASTER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CEXISTPRCPROD-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEXISTPRCPROD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMAINTNOTIFTP-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMAINTNOTIFTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMAINTNOTIFVH-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMAINTNOTIFVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMPESFODEFECT-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPESFODEFECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPAYFRCTRPROP-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPAYFRCTRPROP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOPERBTTHIER-LASTCHANGETIME table field - Posting Period Last Change Time
▼
Description: Posting Period Last Change Time Field Name: LASTCHANGETIME Data Element: POSTINGPERIODCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOPERBTTHIER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRODSPLYITEM-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: VDM_SAEUZ Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRODSPLYITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPROJWPELEMCD-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPROJWPELEMCD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CQNOTIFTSKFDP-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQNOTIFTSKFDP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFKK_VT_D_GFN-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKK_VT_D_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFKK_VT_H_GFN-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKK_VT_H_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFKK_VT_I_GFN-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKK_VT_I_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FDP_QM_DEFECT-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FDP_QM_DEFECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKK_VT_ST_GFN-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_VT_ST_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKK_VT_TR_GFN-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_VT_TR_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBANKCONDITTP-LASTCHANGETIME table field - Time Changed
▼
Description: Time Changed Field Name: LASTCHANGETIME Data Element: BKK_CHTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBANKCONDITTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBDGTDOCBASIC-LASTCHANGETIME table field - Time Stamp for Changed Document
▼
Description: Time Stamp for Changed Document Field Name: LASTCHANGETIME Data Element: BDGT_DOCCHGTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBDGTDOCBASIC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBDGTDOCUMENT-LASTCHANGETIME table field - Time Stamp for Changed Document
▼
Description: Time Stamp for Changed Document Field Name: LASTCHANGETIME Data Element: BDGT_DOCCHGTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBDGTDOCUMENT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBRNFDOCUMENT-LASTCHANGETIME table field - Time when the document was last changed
▼
Description: Time when the document was last changed Field Name: LASTCHANGETIME Data Element: LOGBR_CHATIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBRNFDOCUMENT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICABIPRPRVT_I-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABIPRPRVT_I table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAPAYMENTLOT-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPAYMENTLOT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCCUSTOMERHD-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCCUSTOMERHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCMATERIALHD-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCMATERIALHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCSEGHIERDIR-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCSEGHIERDIR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCSUPPLIERHD-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCSUPPLIERHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICMMDTYSUBITM-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: WLF_AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMDTYSUBITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDMECTREEDRFT-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMECTREEDRFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFASSETKFHIER-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFASSETKFHIER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFMFUNDEDPROG-LASTCHANGETIME table field - Funded Program Changed at Time
▼
Description: Funded Program Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FP_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMFUNDEDPROG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFUNDSCENTERH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFUNDSCENTERH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IINSPSUBSETTP-LASTCHANGETIME table field - System Time at Which Data Record Was Changed
▼
Description: System Time at Which Data Record Was Changed Field Name: LASTCHANGETIME Data Element: VDM_QZEITAEND Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSUBSETTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTNTFTETP-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTNTFTETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGDEFECTSIT-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGDEFECTSIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGORDDEFREC-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGORDDEFREC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGORDERDURN-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGORDERDURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPAYFRCTRPROP-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYFRCTRPROP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPAYMENTREQTP-LASTCHANGETIME table field - Change Time
▼
Description: Change Time Field Name: LASTCHANGETIME Data Element: BNK_COM_CHANGE_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYMENTREQTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPBILLOFOPER-LASTCHANGETIME table field - Time of last change made to the task list
▼
Description: Time of last change made to the task list Field Name: LASTCHANGETIME Data Element: AEUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBILLOFOPER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPFACTORYCAL-LASTCHANGETIME table field - Calendar: Creation or change time
▼
Description: Calendar: Creation or change time Field Name: LASTCHANGETIME Data Element: CRTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPFACTORYCAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPKANBANCONT-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: VDM_SAEUZ Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPKANBANCONT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROJNTWKVERS-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJNTWKVERS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRVDRCONTRTR-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRVDRCONTRTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPUBSECBRFMSG-LASTCHANGETIME table field - Time of status change
▼
Description: Time of status change Field Name: LASTCHANGETIME Data Element: CSTIM_PS Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECBRFMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYNTFITMTP-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNTFITMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IREOBJADDRESS-LASTCHANGETIME table field - Last Edited at
▼
Description: Last Edited at Field Name: LASTCHANGETIME Data Element: REBDTBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREOBJADDRESS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IREREMINDDATE-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREREMINDDATE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRERENTOBJECT-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRERENTOBJECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRESETTLMTVAR-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRESETTLMTVAR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDEFECT_TP_D-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEFECT_TP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISEASONMASTER-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: FSH_CHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISEASONMASTER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISGRANTCORETP-LASTCHANGETIME table field - Last Modified Time
▼
Description: Last Modified Time Field Name: LASTCHANGETIME Data Element: GM_LAST_MODIFIED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: GM_CREATED_AT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGRANTCORETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODUCTWD_D-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODUCTWD_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ITMBPBYINTKEY-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITMBPBYINTKEY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ITRGTUSERDATA-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITRGTUSERDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PIFMEGENATT07-LASTCHANGETIME table field -
▼
Description: Field Name: LASTCHANGETIME Data Element: Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PIFMEGENATT07 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMD_S_PRODUCT-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMD_S_PRODUCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMFGORDDEFREC-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMFGORDDEFREC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
POUTFRMGENATT-LASTCHANGETIME table field -
▼
Description: Field Name: LASTCHANGETIME Data Element: Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POUTFRMGENATT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSAVEDSIMDRFT-LASTCHANGETIME table field - Simulation: Changed On Time
▼
Description: Simulation: Changed On Time Field Name: LASTCHANGETIME Data Element: VCHCLF_SIM_CHANGED_ON_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSAVEDSIMDRFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSIMFORSEARCH-LASTCHANGETIME table field - Simulation: Changed On Time
▼
Description: Simulation: Changed On Time Field Name: LASTCHANGETIME Data Element: VCHCLF_SIM_CHANGED_ON_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIMFORSEARCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VCH_SIM_DRAFT-LASTCHANGETIME table field - Simulation: Changed On Time
▼
Description: Simulation: Changed On Time Field Name: LASTCHANGETIME Data Element: VCHCLF_SIM_CHANGED_ON_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VCH_SIM_DRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
V_QTSK_DR2ACT-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_QTSK_DR2ACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/DMBE/IBUSPART-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/IBUSPART table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ABPPAYBT_DRAFT-LASTCHANGETIME table field - Hash Value (160 Bits)
▼
Description: Hash Value (160 Bits) Field Name: LASTCHANGETIME Data Element: HASH160 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ABPPAYBT_DRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ACAPRVDRCONTRH-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACAPRVDRCONTRH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ACAPRVDRCONTRI-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACAPRVDRCONTRI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ALOCDRAFTLOCKV-LASTCHANGETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: LASTCHANGETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ALOCDRAFTLOCKV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
API_KANBANCONT-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: VDM_SAEUZ Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP API_KANBANCONT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBANKACCOUNTTP-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBANKACCOUNTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAINVOVWVTKEY-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINVOVWVTKEY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CGMGRANTCORETP-LASTCHANGETIME table field - Last Modified Time
▼
Description: Last Modified Time Field Name: LASTCHANGETIME Data Element: GM_LAST_MODIFIED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: GM_CREATED_AT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGMGRANTCORETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMPOMFGORDCUST-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPOMFGORDCUST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
COPENPOSTGPERD-LASTCHANGETIME table field - Posting Period Last Change Time
▼
Description: Posting Period Last Change Time Field Name: LASTCHANGETIME Data Element: POSTINGPERIODCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COPENPOSTGPERD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRODSPLYITEMD-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: VDM_SAEUZ Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRODSPLYITEMD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPROJGENINFOCD-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPROJGENINFOCD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPROJSTSAREACD-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPROJSTSAREACD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRSOLPROCQTSK-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRSOLPROCQTSK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CQLTYNTFITMFDP-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYNTFITMFDP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSRVDOCHDRNOTE-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: TDLTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVDOCHDRNOTE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSRVDOCITMNOTE-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: TDLTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVDOCITMNOTE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFKKPP_HIS_GFN-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: AETIM_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKPP_HIS_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFKK_VT_ST_GFN-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKK_VT_ST_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFKK_VT_TR_GFN-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKK_VT_TR_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBANKHIERARCHY-LASTCHANGETIME table field -
▼
Description: Field Name: LASTCHANGETIME Data Element: Data Type: CHAR length (Dec): 14(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBANKHIERARCHY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBRNFDOCADMINC-LASTCHANGETIME table field - Time when the document was last changed
▼
Description: Time when the document was last changed Field Name: LASTCHANGETIME Data Element: LOGBR_CHATIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBRNFDOCADMINC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICABUSLOCKHIST-LASTCHANGETIME table field - Time
▼
Description: Time Field Name: LASTCHANGETIME Data Element: UZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABUSLOCKHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAPAYTLOTITEM-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPAYTLOTITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAPRVDRCONTRH-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPRVDRCONTRH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAPRVDRCONTRI-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPRVDRCONTRI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDEFAULTABLEBP-LASTCHANGETIME table field - Last Changed Time
▼
Description: Last Changed Time Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDEFAULTABLEBP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDMECPRPTYDRFT-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMECPRPTYDRFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIBANKACCOUNT-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIBANKACCOUNT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIBANKACC_VH1-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIBANKACC_VH1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFMFUNDEDPROGB-LASTCHANGETIME table field - Funded Program Changed at Time
▼
Description: Funded Program Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FP_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMFUNDEDPROGB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IGMGRANTCORETP-LASTCHANGETIME table field - Last Modified Time
▼
Description: Last Modified Time Field Name: LASTCHANGETIME Data Element: GM_LAST_MODIFIED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: GM_CREATED_AT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMGRANTCORETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IINHREPAIRNOTE-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: TDLTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINHREPAIRNOTE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IINSPSUBSETTP2-LASTCHANGETIME table field - System Time at Which Data Record Was Changed
▼
Description: System Time at Which Data Record Was Changed Field Name: LASTCHANGETIME Data Element: VDM_QZEITAEND Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSUBSETTP2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ILOGISTCSORDER-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILOGISTCSORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGBILLOFOPER-LASTCHANGETIME table field - Time of last change made to the task list
▼
Description: Time of last change made to the task list Field Name: LASTCHANGETIME Data Element: AEUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBILLOFOPER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGORDERWSTTS-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGORDERWSTTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMNTTASKGRPCTR-LASTCHANGETIME table field - Time of last change made to the task list
▼
Description: Time of last change made to the task list Field Name: LASTCHANGETIME Data Element: AEUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMNTTASKGRPCTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPEMANORDERTP-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPEMANORDERTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INOTIFTSKTSLTZ-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFTSKTSLTZ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IOPENPOSTGPERD-LASTCHANGETIME table field - Posting Period Last Change Time
▼
Description: Posting Period Last Change Time Field Name: LASTCHANGETIME Data Element: POSTINGPERIODCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IOPENPOSTGPERD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROCORDWTHSTS-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROCORDWTHSTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROJGENINFOCD-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJGENINFOCD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROJSTRUCHIER-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJSTRUCHIER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROJSTSAREACD-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJSTSAREACD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRVDRCONTRIST-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRVDRCONTRIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IQLTYDFCTUNION-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYDFCTUNION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRETAXCORRITEM-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRETAXCORRITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRRBSLSPRHDRTP-LASTCHANGETIME table field - System Time
▼
Description: System Time Field Name: LASTCHANGETIME Data Element: SYUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRRBSLSPRHDRTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDEFECT_TP_DR-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEFECT_TP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISLSPRVDRCONTR-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSPRVDRCONTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMANAGEORDERS-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMANAGEORDERS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUBITMHIERDIR-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUBITMHIERDIR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTITEMTXT_D-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: TDLTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTITEMTXT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTWORKREQ_D-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTWORKREQ_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PEMPLOYEEUNION-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEMPLOYEEUNION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PESHSEARCHVIEW-LASTCHANGETIME table field - Last changed at
▼
Description: Last changed at Field Name: LASTCHANGETIME Data Element: AS4TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: AS4TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PESHSEARCHVIEW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMFGDEFECTHIST-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMFGDEFECTHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRTGOPERHDRESH-LASTCHANGETIME table field - Time of last change made to the task list
▼
Description: Time of last change made to the task list Field Name: LASTCHANGETIME Data Element: AEUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRTGOPERHDRESH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RECP_FDP_CLERK-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_FDP_CLERK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RECP_PARTNER_C-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_PARTNER_C table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PLMI/C_ER_CIAH-LASTCHANGETIME table field - Change Time for Change Item
▼
Description: Change Time for Change Item Field Name: LASTCHANGETIME Data Element: /PLMI/S_ECR_CI_MOD_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/C_ER_CIAH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PLMI/C_ER_CIAI-LASTCHANGETIME table field - Change Time for Change Item
▼
Description: Change Time for Change Item Field Name: LASTCHANGETIME Data Element: /PLMI/S_ECR_CI_MOD_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/C_ER_CIAI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PLMI/C_ER_CIPV-LASTCHANGETIME table field - Change Time for Change Item
▼
Description: Change Time for Change Item Field Name: LASTCHANGETIME Data Element: /PLMI/S_ECR_CI_MOD_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/C_ER_CIPV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ASEASONMMPERIOD-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: FSH_CHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASEASONMMPERIOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ASEASONPPPERIOD-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: FSH_CHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASEASONPPPERIOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAREPAYMENTREQ-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAREPAYMENTREQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPROJMLSTELEMCD-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPROJMLSTELEMCD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPUBSECBRFMSGTP-LASTCHANGETIME table field - Time of status change
▼
Description: Time of status change Field Name: LASTCHANGETIME Data Element: CSTIM_PS Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPUBSECBRFMSGTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRECONTRACTVALQ-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRECONTRACTVALQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CWCBMNTRROYTYCC-LASTCHANGETIME table field - Time of Last Condition Contract Change
▼
Description: Time of Last Condition Contract Change Field Name: LASTCHANGETIME Data Element: WCB_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: WCB_CHANGED_AT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWCBMNTRROYTYCC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DMECD_TREE_HEAD-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DMECD_TREE_HEAD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKCOLLITEM_GFN-LASTCHANGETIME table field - Time the object was last changed
▼
Description: Time the object was last changed Field Name: LASTCHANGETIME Data Element: ACPTM_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKCOLLITEM_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
GMC_D_GRANT_DFT-LASTCHANGETIME table field - Last Modified Time
▼
Description: Last Modified Time Field Name: LASTCHANGETIME Data Element: GM_LAST_MODIFIED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: GM_CREATED_AT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GMC_D_GRANT_DFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBANKFEESERVMAP-LASTCHANGETIME table field - Last Changed Time
▼
Description: Last Changed Time Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBANKFEESERVMAP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAPRVDRCONTRTR-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPRVDRCONTRTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAREPAYMENTREQ-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAREPAYMENTREQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCCOSTCENTERHD-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCCOSTCENTERHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCFSITMHIERDIR-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCFSITMHIERDIR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIBUSTRANTYPEH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIBUSTRANTYPEH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFISTGLACCOUNTH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFISTGLACCOUNTH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFMBDGTDOCBASIC-LASTCHANGETIME table field - Time at which the object was changed
▼
Description: Time at which the object was changed Field Name: LASTCHANGETIME Data Element: BUKU_CHGTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBDGTDOCBASIC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IHANDLINGUNITHD-LASTCHANGETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: LASTCHANGETIME Data Element: AEZET Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IHANDLINGUNITHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTNTFTECOBJ-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTNTFTECOBJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMNTOBJSTLSTCHG-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMNTOBJSTLSTCHG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPAYTREQCHGDATA-LASTCHANGETIME table field - Change Time
▼
Description: Change Time Field Name: LASTCHANGETIME Data Element: BNK_COM_CHANGE_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYTREQCHGDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPKANBANCCITEM-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: VDM_SAEUZ Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPKANBANCCITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPMFGORDBSCFLT-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMFGORDBSCFLT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROJECTNETWORK-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJECTNETWORK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPUBSECBRFMSGTP-LASTCHANGETIME table field - Time of status change
▼
Description: Time of status change Field Name: LASTCHANGETIME Data Element: CSTIM_PS Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECBRFMSGTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRECONTRACTBASE-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRECONTRACTBASE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IREINTOBJECTBSC-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREINTOBJECTBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IREREGISTRATION-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREREGISTRATION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRRBSLSPRHEADER-LASTCHANGETIME table field - System Time
▼
Description: System Time Field Name: LASTCHANGETIME Data Element: SYUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRRBSLSPRHEADER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBANKACCOUNTTP-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKACCOUNTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISEASONMMPERIOD-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: FSH_CHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISEASONMMPERIOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISEASONPPPERIOD-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: FSH_CHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISEASONPPPERIOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISEASONSDPERIOD-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: FSH_CHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISEASONSDPERIOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISGRANTCORETP_D-LASTCHANGETIME table field - Last Modified Time
▼
Description: Last Modified Time Field Name: LASTCHANGETIME Data Element: GM_LAST_MODIFIED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: GM_CREATED_AT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGRANTCORETP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISLSPRVDCONTRTR-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSPRVDCONTRTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISLSPRVDRCONTRH-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSPRVDRCONTRH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISLSPRVDRCONTRI-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSPRVDRCONTRI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPRODUCTWD2_DR-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODUCTWD2_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISQUALITYTASKTP-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYTASKTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRVDOCHEADNOTE-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: TDLTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVDOCHEADNOTE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OPENPOSTGPERIOD-LASTCHANGETIME table field - Posting Period Last Change Time
▼
Description: Posting Period Last Change Time Field Name: LASTCHANGETIME Data Element: POSTINGPERIODCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OPENPOSTGPERIOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PALLOFUNCAREAVH-LASTCHANGETIME table field - Functional Area Changed at Time
▼
Description: Functional Area Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FAREA_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PALLOFUNCAREAVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMD_S_PROD_DATA-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMD_S_PROD_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
POUTFRMGENATT08-LASTCHANGETIME table field -
▼
Description: Field Name: LASTCHANGETIME Data Element: Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POUTFRMGENATT08 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPROCORDMGMTBSC-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROCORDMGMTBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
QINSPSUBSETRR_D-LASTCHANGETIME table field - System Time at Which Data Record Was Changed
▼
Description: System Time at Which Data Record Was Changed Field Name: LASTCHANGETIME Data Element: VDM_QZEITAEND Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINSPSUBSETRR_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/DMBE/IBUSPARTSE-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/IBUSPARTSE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PLMI/C_ER_CIDIR-LASTCHANGETIME table field - Change Time for Change Item
▼
Description: Change Time for Change Item Field Name: LASTCHANGETIME Data Element: /PLMI/S_ECR_CI_MOD_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/C_ER_CIDIR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PLMI/C_ER_CILBL-LASTCHANGETIME table field - Change Time for Change Item
▼
Description: Change Time for Change Item Field Name: LASTCHANGETIME Data Element: /PLMI/S_ECR_CI_MOD_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/C_ER_CILBL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PLMI/C_ER_CIMAT-LASTCHANGETIME table field - Change Time for Change Item
▼
Description: Change Time for Change Item Field Name: LASTCHANGETIME Data Element: /PLMI/S_ECR_CI_MOD_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/C_ER_CIMAT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PLMI/C_ER_CIMBM-LASTCHANGETIME table field - Change Time for Change Item
▼
Description: Change Time for Change Item Field Name: LASTCHANGETIME Data Element: /PLMI/S_ECR_CI_MOD_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/C_ER_CIMBM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PLMI/C_ER_CIMIM-LASTCHANGETIME table field - Change Time for Change Item
▼
Description: Change Time for Change Item Field Name: LASTCHANGETIME Data Element: /PLMI/S_ECR_CI_MOD_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/C_ER_CIMIM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PLMI/C_ER_CIPIV-LASTCHANGETIME table field - Change Time for Change Item
▼
Description: Change Time for Change Item Field Name: LASTCHANGETIME Data Element: /PLMI/S_ECR_CI_MOD_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/C_ER_CIPIV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PLMI/C_ER_CIRCP-LASTCHANGETIME table field - Change Time for Change Item
▼
Description: Change Time for Change Item Field Name: LASTCHANGETIME Data Element: /PLMI/S_ECR_CI_MOD_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/C_ER_CIRCP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PLMI/C_ER_CISUB-LASTCHANGETIME table field - Change Time for Change Item
▼
Description: Change Time for Change Item Field Name: LASTCHANGETIME Data Element: /PLMI/S_ECR_CI_MOD_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/C_ER_CISUB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ABUSINESSPARTNER-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ABUSINESSPARTNER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
AFIINTERNALORDER-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AFIINTERNALORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ASEASONSDPERIODS-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: FSH_CHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASEASONSDPERIODS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BDGT_D_HDR_DRAFT-LASTCHANGETIME table field - Time Stamp for Changed Document
▼
Description: Time Stamp for Changed Document Field Name: LASTCHANGETIME Data Element: BDGT_DOCCHGTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BDGT_D_HDR_DRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBNKPAYMENTBATCH-LASTCHANGETIME table field - Change Time
▼
Description: Change Time Field Name: LASTCHANGETIME Data Element: BNK_COM_CHANGE_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBNKPAYMENTBATCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBUSINESSPARTNER-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBUSINESSPARTNER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CLISTCNDNPRODUCT-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CLISTCNDNPRODUCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMDQLTYPRODPLRES-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDQLTYPRODPLRES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMFSA_S_SUBACCT-LASTCHANGETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: LASTCHANGETIME Data Element: AEZET Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMFSA_S_SUBACCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMS4S_IU_PRD_BL-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_IU_PRD_BL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CWCBMNGCUSTCONTR-LASTCHANGETIME table field - Time of Last Condition Contract Change
▼
Description: Time of Last Condition Contract Change Field Name: LASTCHANGETIME Data Element: WCB_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: WCB_CHANGED_AT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWCBMNGCUSTCONTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CWCBMNGSUPLRCONT-LASTCHANGETIME table field - Time of Last Condition Contract Change
▼
Description: Time of Last Condition Contract Change Field Name: LASTCHANGETIME Data Element: WCB_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: WCB_CHANGED_AT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWCBMNGSUPLRCONT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DMEEXTESTVARIANT-LASTCHANGETIME table field - Last Change Time
▼
Description: Last Change Time Field Name: LASTCHANGETIME Data Element: DMEEXTEST_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DMEEXTESTVARIANT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_L_FUNDED_PRG-LASTCHANGETIME table field - Funded Program Changed at Time
▼
Description: Funded Program Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FP_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_FUNDED_PRG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_U_FUNDED_PRG-LASTCHANGETIME table field - Funded Program Changed at Time
▼
Description: Funded Program Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FP_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_FUNDED_PRG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINSV_PSTGPERIOD-LASTCHANGETIME table field - Posting Period Last Change Time
▼
Description: Posting Period Last Change Time Field Name: LASTCHANGETIME Data Element: POSTINGPERIODCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINSV_PSTGPERIOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FMC_D_FUNCAR_DFT-LASTCHANGETIME table field - Functional Area Changed at Time
▼
Description: Functional Area Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FAREA_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMC_D_FUNCAR_DFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FMFUNCAREA_DRAFT-LASTCHANGETIME table field - Functional Area Changed at Time
▼
Description: Functional Area Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FAREA_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMFUNCAREA_DRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FMFUNDEDPR_DRAFT-LASTCHANGETIME table field - Funded Program Changed at Time
▼
Description: Funded Program Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FP_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMFUNDEDPR_DRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBDGTDOCHEADERTP-LASTCHANGETIME table field - Time Stamp for Changed Document
▼
Description: Time Stamp for Changed Document Field Name: LASTCHANGETIME Data Element: BDGT_DOCCHGTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBDGTDOCHEADERTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBNKPAYMENTBATCH-LASTCHANGETIME table field - Change Time
▼
Description: Change Time Field Name: LASTCHANGETIME Data Element: BNK_COM_CHANGE_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBNKPAYMENTBATCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBUSINESSPARTNER-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBUSINESSPARTNER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICARETURNLOTITEM-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICARETURNLOTITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IEWMINBDELIVITEM-LASTCHANGETIME table field - UTC Date and Time
▼
Description: UTC Date and Time Field Name: LASTCHANGETIME Data Element: /SCWM/DE_TS_WOCVT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEWMINBDELIVITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFCOSTCTRACTTYPH-LASTCHANGETIME table field - Last Updated At (Timestamp)
▼
Description: Last Updated At (Timestamp) Field Name: LASTCHANGETIME Data Element: HRYUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFCOSTCTRACTTYPH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIBAMCHGREQUEST-LASTCHANGETIME table field - Time of Entry
▼
Description: Time of Entry Field Name: LASTCHANGETIME Data Element: CPUTM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIBAMCHGREQUEST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIINTERNALORDER-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIINTERNALORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IINHREPAITEMNOTE-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: TDLTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINHREPAITEMNOTE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IJPINVCSUMMARYVA-LASTCHANGETIME table field - Changing Time
▼
Description: Changing Time Field Name: LASTCHANGETIME Data Element: ISJPCHANTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: ISJPCHANTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IJPINVCSUMMARYVA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPACKINSTRHEADER-LASTCHANGETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: LASTCHANGETIME Data Element: AEZET Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPACKINSTRHEADER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPLANTMAINTPARTN-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPLANTMAINTPARTN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROCORDMGMTCALC-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROCORDMGMTCALC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROCORDMGMTLIST-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROCORDMGMTLIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRVDRCONTRIDISC-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRVDRCONTRIDISC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRECONTRACTVALID-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRECONTRACTVALID table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IREREGISTRATDONE-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREREGISTRATDONE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IREREGISTRATMERG-LASTCHANGETIME table field - Last Edited At
▼
Description: Last Edited At Field Name: LASTCHANGETIME Data Element: TBEAR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREREGISTRATMERG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRFMMASTERORDDUR-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: FSH_CHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMASTERORDDUR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISEASONBASICTEXT-LASTCHANGETIME table field - Time at Which the Object Was Last Changed
▼
Description: Time at Which the Object Was Last Changed Field Name: LASTCHANGETIME Data Element: FSH_CHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISEASONBASICTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISGRANTCORETP_DR-LASTCHANGETIME table field - Last Modified Time
▼
Description: Last Modified Time Field Name: LASTCHANGETIME Data Element: GM_LAST_MODIFIED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: GM_CREATED_AT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGRANTCORETP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMANAGEORDERSTP-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMANAGEORDERSTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMANAGEORDERS_D-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMANAGEORDERS_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISTATUSOBJSTSCH2-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTATUSOBJSTSCH2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISTATUSOBJSTSCHG-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTATUSOBJSTSCHG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTITMCSETXT_D-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: TDLTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTITMCSETXT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTITMRSNTXT_D-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: TDLTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTITMRSNTXT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTNTFTECOBJ_D-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTNTFTECOBJ_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MPES_EXEC_DEFECT-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPES_EXEC_DEFECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PEWMINBDELIVITEM-LASTCHANGETIME table field - UTC Date and Time
▼
Description: UTC Date and Time Field Name: LASTCHANGETIME Data Element: /SCWM/DE_TS_WOCVT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEWMINBDELIVITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPROCORDMGMTCALC-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROCORDMGMTCALC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RBNKPAYMENTBATCH-LASTCHANGETIME table field - Change Time
▼
Description: Change Time Field Name: LASTCHANGETIME Data Element: BNK_COM_CHANGE_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RBNKPAYMENTBATCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RECP_FDP_PARTNER-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_FDP_PARTNER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RECP_RECIPIENT_C-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_RECIPIENT_C table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VFCLM_BM_BANKFEE-LASTCHANGETIME table field - Last Changed Time
▼
Description: Last Changed Time Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VFCLM_BM_BANKFEE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VOPENPOSTGPERIOD-LASTCHANGETIME table field - Posting Period Last Change Time
▼
Description: Posting Period Last Change Time Field Name: LASTCHANGETIME Data Element: POSTINGPERIODCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VOPENPOSTGPERIOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMS4S_IU_PRD_QRY-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_IU_PRD_QRY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBANKACCOUNTTP_D-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKACCOUNTTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBANKCONDITIONTP-LASTCHANGETIME table field - Time Changed
▼
Description: Time Changed Field Name: LASTCHANGETIME Data Element: BKK_CHTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKCONDITIONTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISFUNDEDPROGRAMTP-LASTCHANGETIME table field - Funded Program Changed at Time
▼
Description: Funded Program Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FP_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFUNDEDPROGRAMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISQUALITYTASKTP_D-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYTASKTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SDCI_ODATA_TEXT_S-LASTCHANGETIME table field - Time
▼
Description: Time Field Name: LASTCHANGETIME Data Element: UZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDCI_ODATA_TEXT_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMS4S_IU_PRD_ATTR-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_IU_PRD_ATTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FCLM_BAM_S_AMD_EXT-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCLM_BAM_S_AMD_EXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKK_VT_CHANGES_GFN-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_VT_CHANGES_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKK_VT_CHANGES_GFN-LASTCHANGETIME table field - Last Changed At
▼
Description: Last Changed At Field Name: LASTCHANGETIME Data Element: AETIM2_KK Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_VT_CHANGES_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBANKACCOUNTTP_DR-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKACCOUNTTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBUDGETDOCUMENTTP-LASTCHANGETIME table field - Time Stamp for Changed Document
▼
Description: Time Stamp for Changed Document Field Name: LASTCHANGETIME Data Element: BDGT_DOCCHGTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUDGETDOCUMENTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCAMASTERDATAIDTP-LASTCHANGETIME table field - Last changed at
▼
Description: Last changed at Field Name: LASTCHANGETIME Data Element: AS4TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: AS4TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAMASTERDATAIDTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMANAGEORDERSTP_D-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMANAGEORDERSTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYMENTREQUESTTP-LASTCHANGETIME table field - Change Time
▼
Description: Change Time Field Name: LASTCHANGETIME Data Element: BNK_COM_CHANGE_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYMENTREQUESTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISQUALITYTASKTP_DR-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYTASKTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMD_S_PRODUCT_ATTR-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMD_S_PRODUCT_ATTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPDS_ODATA_SCH_PCM-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: /SAPAPO/MODTS Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: /SAPAPO/DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPDS_ODATA_SCH_PCM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
REBP_PARTNER_RUSER-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REBP_PARTNER_RUSER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RECP_FDP_RECIPIENT-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_FDP_RECIPIENT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_S_WUPC_PCG_INFO-LASTCHANGETIME table field - Last changed at
▼
Description: Last changed at Field Name: LASTCHANGETIME Data Element: UPTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_WUPC_PCG_INFO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FCOS_INTERNAL_ORDER-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FIS_CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCOS_INTERNAL_ORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FDP_QM_DEFECT_TASKS-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FDP_QM_DEFECT_TASKS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISABPPAYMENTBATCHTP-LASTCHANGETIME table field - Hash Value (160 Bits)
▼
Description: Hash Value (160 Bits) Field Name: LASTCHANGETIME Data Element: HASH160 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISABPPAYMENTBATCHTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISALLOCATIONCYCLETP-LASTCHANGETIME table field - Hash Value (160 Bits)
▼
Description: Hash Value (160 Bits) Field Name: LASTCHANGETIME Data Element: HASH160 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISALLOCATIONCYCLETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBANKCONDITIONTP_D-LASTCHANGETIME table field - Time Changed
▼
Description: Time Changed Field Name: LASTCHANGETIME Data Element: BKK_CHTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKCONDITIONTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBUSINESSPARTNERTP-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBUSINESSPARTNERWD-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISFUNDEDPROGRAMTP_D-LASTCHANGETIME table field - Funded Program Changed at Time
▼
Description: Funded Program Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FP_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFUNDEDPROGRAMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBANKCONDITIONTP_DR-LASTCHANGETIME table field - Time Changed
▼
Description: Time Changed Field Name: LASTCHANGETIME Data Element: BKK_CHTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKCONDITIONTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBUDGETDOCUMENTTP_D-LASTCHANGETIME table field - Time Stamp for Changed Document
▼
Description: Time Stamp for Changed Document Field Name: LASTCHANGETIME Data Element: BDGT_DOCCHGTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUDGETDOCUMENTTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBUSINESSPARTNERWD1-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERWD1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBUSINESSPARTNERWD5-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERWD5 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCAMASTERDATAIDTP_D-LASTCHANGETIME table field - Last changed at
▼
Description: Last changed at Field Name: LASTCHANGETIME Data Element: AS4TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: AS4TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAMASTERDATAIDTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISFUNDEDPROGRAMTP_DR-LASTCHANGETIME table field - Funded Program Changed at Time
▼
Description: Funded Program Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FP_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFUNDEDPROGRAMTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPECTIONSUBSETTP-LASTCHANGETIME table field - System Time at Which Data Record Was Changed
▼
Description: System Time at Which Data Record Was Changed Field Name: LASTCHANGETIME Data Element: VDM_QZEITAEND Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAKEBANKTRANSFERTP-LASTCHANGETIME table field - Creation Time
▼
Description: Creation Time Field Name: LASTCHANGETIME Data Element: TTET_DT_CR_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TTE_DT_TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAKEBANKTRANSFERTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYMENTREQUESTTP_D-LASTCHANGETIME table field - Change Time
▼
Description: Change Time Field Name: LASTCHANGETIME Data Element: BNK_COM_CHANGE_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYMENTREQUESTTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYTFRMTCUSTTREETP-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYTFRMTCUSTTREETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PARTNER_CENTRAL_INFO-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARTNER_CENTRAL_INFO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RECP_PARTNER_SPEC1_C-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_PARTNER_SPEC1_C table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RECP_PARTNER_SPEC2_C-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_PARTNER_SPEC2_C table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
REMOB_BROKER_PARTNER-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REMOB_BROKER_PARTNER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PM0/ABD_CHIP_BP_DATA-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PM0/ABD_CHIP_BP_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMD_PRD_S_RFC_PACKAGE-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMD_PRD_S_RFC_PACKAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMS4S_IU_PRD_BL_DATA-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_IU_PRD_BL_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMST_EMP_OBJECT_BUIL-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMST_EMP_OBJECT_BUIL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_S_ODATA_FLEX_HIER-LASTCHANGETIME table field - Flexible Hierarchy Last Update Date Time
▼
Description: Flexible Hierarchy Last Update Date Time Field Name: LASTCHANGETIME Data Element: FHUPDTIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_ODATA_FLEX_HIER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISABPPAYMENTBATCHTP_D-LASTCHANGETIME table field - Hash Value (160 Bits)
▼
Description: Hash Value (160 Bits) Field Name: LASTCHANGETIME Data Element: HASH160 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISABPPAYMENTBATCHTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISALLOCATIONCYCLETP_D-LASTCHANGETIME table field - Hash Value (160 Bits)
▼
Description: Hash Value (160 Bits) Field Name: LASTCHANGETIME Data Element: HASH160 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISALLOCATIONCYCLETP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBANKCONDITIONITEMTP-LASTCHANGETIME table field - Time Changed
▼
Description: Time Changed Field Name: LASTCHANGETIME Data Element: BKK_CHTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKCONDITIONITEMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBUDGETDOCUMENTTP_DR-LASTCHANGETIME table field - Time Stamp for Changed Document
▼
Description: Time Stamp for Changed Document Field Name: LASTCHANGETIME Data Element: BDGT_DOCCHGTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUDGETDOCUMENTTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBUSINESSPARTNERTP_D-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBUSINESSPARTNERWD_D-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERWD_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCAMASTERDATAIDTP_DR-LASTCHANGETIME table field - Last changed at
▼
Description: Last changed at Field Name: LASTCHANGETIME Data Element: AS4TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: AS4TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAMASTERDATAIDTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPECTIONSUBSETTP2-LASTCHANGETIME table field - System Time at Which Data Record Was Changed
▼
Description: System Time at Which Data Record Was Changed Field Name: LASTCHANGETIME Data Element: VDM_QZEITAEND Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFICATIONTP-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYMENTREQUESTTP_DR-LASTCHANGETIME table field - Change Time
▼
Description: Change Time Field Name: LASTCHANGETIME Data Element: BNK_COM_CHANGE_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYMENTREQUESTTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
REBP_PARTNER_COMPLETE-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REBP_PARTNER_COMPLETE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMD_PRD_S_PRODUCT_DATA-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMD_PRD_S_PRODUCT_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISABPPAYMENTBATCHTP_DR-LASTCHANGETIME table field - Hash Value (160 Bits)
▼
Description: Hash Value (160 Bits) Field Name: LASTCHANGETIME Data Element: HASH160 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISABPPAYMENTBATCHTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISALLOCATIONCYCLETP_DR-LASTCHANGETIME table field - Hash Value (160 Bits)
▼
Description: Hash Value (160 Bits) Field Name: LASTCHANGETIME Data Element: HASH160 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISALLOCATIONCYCLETP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBUSINESSPARTNERTP_DR-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBUSINESSPARTNERWD1_D-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERWD1_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBUSINESSPARTNERWD5_D-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERWD5_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPECTIONSUBSETTP_2-LASTCHANGETIME table field - System Time at Which Data Record Was Changed
▼
Description: System Time at Which Data Record Was Changed Field Name: LASTCHANGETIME Data Element: QZEITAEND Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP_2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPECTIONSUBSETTP_D-LASTCHANGETIME table field - System Time at Which Data Record Was Changed
▼
Description: System Time at Which Data Record Was Changed Field Name: LASTCHANGETIME Data Element: VDM_QZEITAEND Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAKEBANKTRANSFERTP_D-LASTCHANGETIME table field - Creation Time
▼
Description: Creation Time Field Name: LASTCHANGETIME Data Element: TTET_DT_CR_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TTE_DT_TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAKEBANKTRANSFERTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYTFRMTCUSTTREETP_D-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYTFRMTCUSTTREETP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RECP_FDP_PARTNER_SPEC1-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_FDP_PARTNER_SPEC1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RECP_FDP_PARTNER_SPEC2-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_FDP_PARTNER_SPEC2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMD_MIG_PRD_S_PROD_DATA-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMD_MIG_PRD_S_PROD_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMD_PRD_S_RFC_PACKAGE_2-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMD_PRD_S_RFC_PACKAGE_2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EAMS_S_BO_STATUS_CHANGE-LASTCHANGETIME table field - Time changed
▼
Description: Time changed Field Name: LASTCHANGETIME Data Element: CDUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMS_S_BO_STATUS_CHANGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FCLM_BAM_ACCOUNT_HEADER-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCLM_BAM_ACCOUNT_HEADER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBANKCONDITIONITEMTP_D-LASTCHANGETIME table field - Time Changed
▼
Description: Time Changed Field Name: LASTCHANGETIME Data Element: BKK_CHTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKCONDITIONITEMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPECTIONSUBSETTP2_D-LASTCHANGETIME table field - System Time at Which Data Record Was Changed
▼
Description: System Time at Which Data Record Was Changed Field Name: LASTCHANGETIME Data Element: VDM_QZEITAEND Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPECTIONSUBSETTP_DR-LASTCHANGETIME table field - System Time at Which Data Record Was Changed
▼
Description: System Time at Which Data Record Was Changed Field Name: LASTCHANGETIME Data Element: VDM_QZEITAEND Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFICATIONTP_D-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAKEBANKTRANSFERTP_DR-LASTCHANGETIME table field - Creation Time
▼
Description: Creation Time Field Name: LASTCHANGETIME Data Element: TTET_DT_CR_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TTE_DT_TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAKEBANKTRANSFERTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYTFRMTCUSTTREETP_DR-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYTFRMTCUSTTREETP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIBUS1006_CENTRAL_INFO-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIBUS1006_CENTRAL_INFO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMST_HEADER_OBJECT_BUIL-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMST_HEADER_OBJECT_BUIL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_S_WUPC_PCG_HIERARCHY-LASTCHANGETIME table field - Time of last change
▼
Description: Time of last change Field Name: LASTCHANGETIME Data Element: UP_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: T MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_WUPC_PCG_HIERARCHY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_PAYMENT_REQUEST_ENH-LASTCHANGETIME table field - Change Time
▼
Description: Change Time Field Name: LASTCHANGETIME Data Element: BNK_COM_CHANGE_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_PAYMENT_REQUEST_ENH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBANKCONDITIONITEMTP_DR-LASTCHANGETIME table field - Time Changed
▼
Description: Time Changed Field Name: LASTCHANGETIME Data Element: BKK_CHTIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKCONDITIONITEMTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISINSPECTIONSUBSETTP_2_D-LASTCHANGETIME table field - System Time at Which Data Record Was Changed
▼
Description: System Time at Which Data Record Was Changed Field Name: LASTCHANGETIME Data Element: QZEITAEND Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP_2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTNOTIFICATIONTP_DR-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBUSPARTRELATIONSHIPTP_2-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSPARTRELATIONSHIPTP_2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYTFRMTCUSTTREEPRPTYTP-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYTFRMTCUSTTREEPRPTYTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRRBSALESPRICINGHEADERTP-LASTCHANGETIME table field - System Time
▼
Description: System Time Field Name: LASTCHANGETIME Data Element: SYUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRRBSALESPRICINGHEADERTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_CHGDOC_TEXT-LASTCHANGETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: LASTCHANGETIME Data Element: AEZET Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_CHGDOC_TEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
AHANDLINGUNITHEADERDELIVERY-LASTCHANGETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: LASTCHANGETIME Data Element: AEZET Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AHANDLINGUNITHEADERDELIVERY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMD_PRD_S_UNIFIED_PROD_DATA-LASTCHANGETIME table field - Time of Last Change
▼
Description: Time of Last Change Field Name: LASTCHANGETIME Data Element: LAST_CHANGED_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMD_PRD_S_UNIFIED_PROD_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBUSPARTRELATIONSHIPTP_2_D-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSPARTRELATIONSHIPTP_2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISFUNDSMGMTFUNCTIONALAREATP-LASTCHANGETIME table field - Functional Area Changed at Time
▼
Description: Functional Area Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FAREA_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFUNDSMGMTFUNCTIONALAREATP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYTFRMTCUSTTREEPRPTYTP_D-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYTFRMTCUSTTREEPRPTYTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPUBLICSECTORBRFMESSAGETP2-LASTCHANGETIME table field - Time of status change
▼
Description: Time of status change Field Name: LASTCHANGETIME Data Element: CSTIM_PS Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRRBSALESPRICINGHEADERTP_D-LASTCHANGETIME table field - System Time
▼
Description: System Time Field Name: LASTCHANGETIME Data Element: SYUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRRBSALESPRICINGHEADERTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FCLM_BAM_S_BANKACCT_REVISION-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: FCLM_BAM_CHANGED_AT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCLM_BAM_S_BANKACCT_REVISION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FSBP_MAP_GENERAL_DATA_BUT000-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FSBP_MAP_GENERAL_DATA_BUT000 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISBUSPARTRELATIONSHIPTP_2_DR-LASTCHANGETIME table field - Time at which object was last changed
▼
Description: Time at which object was last changed Field Name: LASTCHANGETIME Data Element: BU_CHTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSPARTRELATIONSHIPTP_2_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDEFECT_TP_Q_SEL_BY_ROOT_EL-LASTCHANGETIME table field - System Time of Change
▼
Description: System Time of Change Field Name: LASTCHANGETIME Data Element: VDM_QAENDEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEFECT_TP_Q_SEL_BY_ROOT_EL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTWORKREQUESTOVERVIEWTP-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTWORKREQUESTOVERVIEWTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYTFRMTCUSTTREEPRPTYTP_DR-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYTFRMTCUSTTREEPRPTYTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRRBSALESPRICINGHEADERTP_DR-LASTCHANGETIME table field - System Time
▼
Description: System Time Field Name: LASTCHANGETIME Data Element: SYUZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRRBSALESPRICINGHEADERTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MPES_CIMA_PRO_QUICKVIEW_INFO-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPES_CIMA_PRO_QUICKVIEW_INFO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISFUNDSMGMTFUNCTIONALAREATP_D-LASTCHANGETIME table field - Functional Area Changed at Time
▼
Description: Functional Area Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FAREA_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFUNDSMGMTFUNCTIONALAREATP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPUBLICSECTORBRFMESSAGETP2_D-LASTCHANGETIME table field - Time of status change
▼
Description: Time of status change Field Name: LASTCHANGETIME Data Element: CSTIM_PS Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISVARIANTCONFIGURATIONSIMLNTP-LASTCHANGETIME table field - Simulation: Changed On Time
▼
Description: Simulation: Changed On Time Field Name: LASTCHANGETIME Data Element: VCHCLF_SIM_CHANGED_ON_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISVARIANTCONFIGURATIONSIMLNTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MPES_CIMA_NETW_QUICKVIEW_INFO-LASTCHANGETIME table field - Changed At
▼
Description: Changed At Field Name: LASTCHANGETIME Data Element: CO_CHG_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPES_CIMA_NETW_QUICKVIEW_INFO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPWF/ISQUALITYTASKTP______00-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPWF/ISQUALITYTASKTP______00 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISFNDSMGMTFUNCTIONALAREACORETP-LASTCHANGETIME table field - Functional Area Changed at Time
▼
Description: Functional Area Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FAREA_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFNDSMGMTFUNCTIONALAREACORETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISFNDSMGMTFUNCTIONALAREACORE_D-LASTCHANGETIME table field - Functional Area Changed at Time
▼
Description: Functional Area Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FAREA_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFNDSMGMTFUNCTIONALAREACORE_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISFNDSMGMTFUNCTIONALAREACOR_DR-LASTCHANGETIME table field - Functional Area Changed at Time
▼
Description: Functional Area Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FAREA_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFNDSMGMTFUNCTIONALAREACOR_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISFUNDSMGMTFUNCTIONALAREATP_DR-LASTCHANGETIME table field - Functional Area Changed at Time
▼
Description: Functional Area Changed at Time Field Name: LASTCHANGETIME Data Element: FMIS_FAREA_LASTCHANGETIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFUNDSMGMTFUNCTIONALAREATP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTWORKREQUESTOVERVIEWTP_D-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTWORKREQUESTOVERVIEWTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTWORKREQUESTOVERVIEWT_DR-LASTCHANGETIME table field - Time of Change
▼
Description: Time of Change Field Name: LASTCHANGETIME Data Element: AEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UHRZT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTWORKREQUESTOVERVIEWT_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPUBLICSECTORBRFMESSAGETP2_DR-LASTCHANGETIME table field - Time of status change
▼
Description: Time of status change Field Name: LASTCHANGETIME Data Element: CSTIM_PS Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISVARIANTCONFIGURATIONSIMLNT_D-LASTCHANGETIME table field - Simulation: Changed On Time
▼
Description: Simulation: Changed On Time Field Name: LASTCHANGETIME Data Element: VCHCLF_SIM_CHANGED_ON_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISVARIANTCONFIGURATIONSIMLNT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISVARIANTCONFIGURATIONSIMLN_DR-LASTCHANGETIME table field - Simulation: Changed On Time
▼
Description: Simulation: Changed On Time Field Name: LASTCHANGETIME Data Element: VCHCLF_SIM_CHANGED_ON_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: SYTIME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISVARIANTCONFIGURATIONSIMLN_DR table
|