Details |
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CARCUSTOMER-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CARCUSTOMER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPCARDMASTER-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPCARDMASTER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPAYCARDTYPE-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYCARDTYPE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPCARDMASTER-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPCARDMASTER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAPAYTSEARCH-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAPAYTSEARCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CARUNQCUSTOMER-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CARUNQCUSTOMER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPMNTCARDTYPES-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPMNTCARDTYPES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPAYCARDTYPEVH-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPAYCARDTYPEVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPMNTCARDTYPEVH-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPMNTCARDTYPEVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDDOCPAYTCDTYP-PAYMENTCARDTYPE table field - Payment cards: Card type
▼
Description: Payment cards: Card type Field Name: PAYMENTCARDTYPE Data Element: CCINS Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CCINS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDDOCPAYTCDTYP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAPAYTSEARCHLOT-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAPAYTSEARCHLOT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAPAYTSEARCHRUN-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAPAYTSEARCHRUN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAPAYTSRCHRUNPY-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAPAYTSRCHRUNPY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAPAYTRUNHEADER-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPAYTRUNHEADER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPAYCARDTYPETEXT-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYCARDTYPETEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDDOCPAYTCDTYPT-PAYMENTCARDTYPE table field - Payment cards: Card type
▼
Description: Payment cards: Card type Field Name: PAYMENTCARDTYPE Data Element: CCINS Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CCINS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDDOCPAYTCDTYPT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCAPAYMENTSEARCH-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCAPAYMENTSEARCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBSEGC-PAYMENTCARDTYPE table field - Payment cards: Card type
▼
Description: Payment cards: Card type Field Name: PAYMENTCARDTYPE Data Element: CCINS Data Type: CHAR length (Dec): 4(0) Check table: TVCIN Conversion Routine: Domain Name: CCINS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBSEGC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPAYCARD-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPAYCARD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCARD_GFN-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCARD_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBSEGCARD-PAYMENTCARDTYPE table field - Payment cards: Card type
▼
Description: Payment cards: Card type Field Name: PAYMENTCARDTYPE Data Element: CCINS Data Type: CHAR length (Dec): 4(0) Check table: TVCIN Conversion Routine: Domain Name: CCINS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBSEGCARD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFKKOPC_GFN-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKOPC_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDORPCAUTH-PAYMENTCARDTYPE table field - Electronic Payment: Payment Type
▼
Description: Electronic Payment: Payment Type Field Name: PAYMENTCARDTYPE Data Element: VDM_EPAYT_TYPE Data Type: CHAR length (Dec): 4(0) Check table: TVCIN Conversion Routine: Domain Name: CCINS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDORPCAUTH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUPA_CCARD_D-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUPA_CCARD_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCARD_ROOT_D-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCARD_ROOT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFKKOPKC_GFN-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKOPKC_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICADOCBPIPAY-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADOCBPIPAY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICADOCGLIPAY-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADOCGLIPAY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPAYMENTCARD-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYMENTCARD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAPAYGRPPAYM-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAPAYGRPPAYM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_CARD_S-PAYMENTCARDTYPE table field - Digital Payments: Card Type
▼
Description: Digital Payments: Card Type Field Name: PAYMENTCARDTYPE Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_CARD_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBUPPAYCARDTP-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBUPPAYCARDTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICACREDITCARD-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICACREDITCARD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUPA_BUUT0CC_D-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUPA_BUUT0CC_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKPY_PARA_GFN-PAYMENTCARDTYPE table field - Payment card type
▼
Description: Payment card type Field Name: PAYMENTCARDTYPE Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKPY_PARA_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKPY_SRT1_GFN-PAYMENTCARDTYPE table field - Payment cards: Card type
▼
Description: Payment cards: Card type Field Name: PAYMENTCARDTYPE Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKPY_SRT1_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAPAYTLOTITEM-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPAYTLOTITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDDOCPAYTCARD-PAYMENTCARDTYPE table field - Payment cards: Card type
▼
Description: Payment cards: Card type Field Name: PAYMENTCARDTYPE Data Element: CCINS Data Type: CHAR length (Dec): 4(0) Check table: TVCIN Conversion Routine: Domain Name: CCINS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDDOCPAYTCARD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAPAYLISTPAYMT-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAPAYLISTPAYMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAPAYSRCHREPAY-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAPAYSRCHREPAY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFKKPPD_PAY_GFN-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKPPD_PAY_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_SOURCE_S-PAYMENTCARDTYPE table field - Payment Card: Brand
▼
Description: Payment Card: Brand Field Name: PAYMENTCARDTYPE Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_SOURCE_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISLSORDPAYCINFO-PAYMENTCARDTYPE table field - Electronic Payment: Payment Type
▼
Description: Electronic Payment: Payment Type Field Name: PAYMENTCARDTYPE Data Element: VDM_EPAYT_TYPE Data Type: CHAR length (Dec): 4(0) Check table: TVCIN Conversion Routine: Domain Name: CCINS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSORDPAYCINFO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYMENTCARDTP-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: * Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYMENTCARDTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCAPAYLISTPAYMT-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: TB033 Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCAPAYLISTPAYMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDSPPAYTCARDDATA-PAYMENTCARDTYPE table field - Payment cards: Card type
▼
Description: Payment cards: Card type Field Name: PAYMENTCARDTYPE Data Element: CCINS Data Type: CHAR length (Dec): 4(0) Check table: TVCIN Conversion Routine: Domain Name: CCINS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDSPPAYTCARDDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_EXT_PAY_S-PAYMENTCARDTYPE table field - Payment Card: Brand
▼
Description: Payment Card: Brand Field Name: PAYMENTCARDTYPE Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_EXT_PAY_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIVFPAYMENTCARD-PAYMENTCARDTYPE table field - Payment cards: Card type
▼
Description: Payment cards: Card type Field Name: PAYMENTCARDTYPE Data Element: CCINS Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CCINS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIVFPAYMENTCARD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYMENTCARDTP_D-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYMENTCARDTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYMENTCARDTP_DR-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYMENTCARDTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SDBIL_PAYMENT_CARD-PAYMENTCARDTYPE table field - Payment cards: Card type
▼
Description: Payment cards: Card type Field Name: PAYMENTCARDTYPE Data Element: CCINS Data Type: CHAR length (Dec): 4(0) Check table: TVCIN Conversion Routine: Domain Name: CCINS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDBIL_PAYMENT_CARD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYMENTCARDTYPETP-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: * Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYMENTCARDTYPETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_ACDOC_HEADER_IN-PAYMENTCARDTYPE table field - Payment cards: Card type
▼
Description: Payment cards: Card type Field Name: PAYMENTCARDTYPE Data Element: CCINS_30F Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CCINS_30F MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_ACDOC_HEADER_IN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_SETTLMT_S_CARD-PAYMENTCARDTYPE table field - Payment Card: Brand
▼
Description: Payment Card: Brand Field Name: PAYMENTCARDTYPE Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_SETTLMT_S_CARD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIXBIT0_PY_ALL_GFN-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: * Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXBIT0_PY_ALL_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYMENTCARDMASTERTP-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: * Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYMENTCARDMASTERTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYMENTCARDTYPETP_D-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYMENTCARDTYPETP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_REFUND_S_RECORD-PAYMENTCARDTYPE table field - Payment Card: Brand
▼
Description: Payment Card: Brand Field Name: PAYMENTCARDTYPE Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_REFUND_S_RECORD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYMENTCARDTYPETP_DR-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYMENTCARDTYPETP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_SETTLMT_S_RECORD-PAYMENTCARDTYPE table field - Payment Card: Brand
▼
Description: Payment Card: Brand Field Name: PAYMENTCARDTYPE Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_SETTLMT_S_RECORD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_SETTLMT_S_SOURCE-PAYMENTCARDTYPE table field - Payment Card: Brand
▼
Description: Payment Card: Brand Field Name: PAYMENTCARDTYPE Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_SETTLMT_S_SOURCE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYMENTCARDMASTERTP_D-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYMENTCARDMASTERTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_AUTH_S_AUTHS_V2_R-PAYMENTCARDTYPE table field - Payment Card: Brand
▼
Description: Payment Card: Brand Field Name: PAYMENTCARDTYPE Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_AUTH_S_AUTHS_V2_R table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIXBIT_API_PY_ALL_GFN-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: * Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXBIT_API_PY_ALL_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_ICBIT0_PY_ALL_GFN-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: * Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_ICBIT0_PY_ALL_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPAYMENTCARDMASTERTP_DR-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYMENTCARDMASTERTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKC_FDP_PROM2PAY_ITEM_PAY-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: * Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKC_FDP_PROM2PAY_ITEM_PAY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_REFUND_S_RECORD_RES-PAYMENTCARDTYPE table field - Payment Card: Brand
▼
Description: Payment Card: Brand Field Name: PAYMENTCARDTYPE Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_REFUND_S_RECORD_RES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_AUTH_S_AUTHORIZATION-PAYMENTCARDTYPE table field - Payment Card: Brand
▼
Description: Payment Card: Brand Field Name: PAYMENTCARDTYPE Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_AUTH_S_AUTHORIZATION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_SETTLMT_S_RECORD_RES-PAYMENTCARDTYPE table field - Payment Card: Brand
▼
Description: Payment Card: Brand Field Name: PAYMENTCARDTYPE Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_SETTLMT_S_RECORD_RES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_ICBIT_API_PY_ALL_GFN-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: * Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_ICBIT_API_PY_ALL_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_DELETE_CARD_S_MESSAGE-PAYMENTCARDTYPE table field -
▼
Description: Field Name: PAYMENTCARDTYPE Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_DELETE_CARD_S_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIXBIT0_PY_PCARD_DATA_GFN-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXBIT0_PY_PCARD_DATA_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_AUTH_S_AUTHORIZATIONS_R-PAYMENTCARDTYPE table field - Payment Card: Brand
▼
Description: Payment Card: Brand Field Name: PAYMENTCARDTYPE Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_AUTH_S_AUTHORIZATIONS_R table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_AUTH_S_AUTHORIZATION_GR-PAYMENTCARDTYPE table field - Payment Card: Brand
▼
Description: Payment Card: Brand Field Name: PAYMENTCARDTYPE Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_AUTH_S_AUTHORIZATION_GR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_AUTH_S_AUTHORIZATION_V2-PAYMENTCARDTYPE table field - Payment Card: Brand
▼
Description: Payment Card: Brand Field Name: PAYMENTCARDTYPE Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_AUTH_S_AUTHORIZATION_V2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISA_PAYMENTCARDMASTERTP_CREATE-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISA_PAYMENTCARDMASTERTP_CREATE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISA_PAYMENTCARDMASTERTP_UPDATE-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISA_PAYMENTCARDMASTERTP_UPDATE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISK_PAYMENTCARDMASTERTP_ACTIVE-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISK_PAYMENTCARDMASTERTP_ACTIVE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISK_PAYMENTCARDTP_ACTIVE_ENTIT-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISK_PAYMENTCARDTP_ACTIVE_ENTIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISK_PAYMENTCARDTYPETP_ACTIVE_E-PAYMENTCARDTYPE table field - Payment Card Type
▼
Description: Payment Card Type Field Name: PAYMENTCARDTYPE Data Element: CC_INSTITUTE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CC_INSTITUTE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISK_PAYMENTCARDTYPETP_ACTIVE_E table
|