SAP PERFORMANCEPERIODENDDATE field - End Date for Period of Performance details in SAP

Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211

Details

APURREQITM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURREQITM table

IPRSSPITEM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRSSPITEM table

CPOMAINTITM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMAINTITM table

CPRITEMMNTR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRITEMMNTR table

CPURREQNITM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQNITM table

CWIPRITMDET-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWIPRITMDET table

C_MM_PR_LIST-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP C_MM_PR_LIST table

CPOMASSUPDATE-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMASSUPDATE table

IMAINTORDCOMP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTORDCOMP table

IPURREQNITMWD-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNITMWD table

PPOMASSUPDATE-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOMASSUPDATE table

PPRSSPITEMEXT-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRSSPITEMEXT table

CPOMASUPDTNODE-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMASUPDTNODE table

CPOMASUPDTSTRT-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMASUPDTSTRT table

CPOSCHEDLINETP-PERFORMANCEPERIODENDDATE table field - END date ▼ Description: END date Field Name: PERFORMANCEPERIODENDDATE Data Element: ENDDATE_LL Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOSCHEDLINETP table

CPURORDITEMENH-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDITEMENH table

CWIPRHDRITMDET-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWIPRHDRITMDET table

IPURREQNITEMWD-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNITEMWD table

PPOMAINTITMACT-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOMAINTITMACT table

CPURORDITEMMONI-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDITEMMONI table

CPURORDREFDOCIR-PERFORMANCEPERIODENDDATE table field - ▼ Description: Field Name: PERFORMANCEPERIODENDDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDREFDOCIR table

CPURORDREFDOCPC-PERFORMANCEPERIODENDDATE table field - ▼ Description: Field Name: PERFORMANCEPERIODENDDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDREFDOCPC table

CPURORDSUPLCONF-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDSUPLCONF table

C_MM_PRLIST_EXT-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP C_MM_PRLIST_EXT table

ISRVCENTRSHTITM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVCENTRSHTITM table

IWIPRRQHDITMDET-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWIPRRQHDITMDET table

PPOMAINTITEMALL-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOMAINTITEMALL table

CPODELIVSCHEDITM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPODELIVSCHEDITM table

CPOITMMASSUPDATE-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOITMMASSUPDATE table

CPOMAINTREFDOCVH-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMAINTREFDOCVH table

CPOMNTRACCASSIGN-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMNTRACCASSIGN table

CPOSUPLRCONFMAIN-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOSUPLRCONFMAIN table

CSRVCENTRSH000WD-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVCENTRSH000WD table

ISRVCENTRSH000TP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVCENTRSH000TP table

IWIPRHDRITMDETTP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWIPRHDRITMDETTP table

PPOMAINTITMDRAFT-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOMAINTITMDRAFT table

PPOMAINTREFDOCAL-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOMAINTREFDOCAL table

IPRITEM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITEM table

PMNGPRPO-PERFORMANCEPERIODENDDATE table field - ▼ Description: Field Name: PERFORMANCEPERIODENDDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMNGPRPO table

CEXTPRITEM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEXTPRITEM table

ICFINPOSLN-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: FINS_CFIN_AV_SERV_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFINPOSLN table

IPOCONFAPI-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPOCONFAPI table

ISPQTNITEM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPQTNITEM table

CCFINRPOSLN-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: FINS_CFIN_AV_SERV_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCFINRPOSLN table

CMMPRITMDEX-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPRITMDEX table

ICFINRPOSLN-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: FINS_CFIN_AV_SERV_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFINRPOSLN table

IPRITMAPI01-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITMAPI01 table

IPURREQNITM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNITM table

ISUPPLCONFL-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPPLCONFL table

MMSRCGPITEM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCGPITEM table

PMMPURORDSS-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPURORDSS table

PMMRPLDPOSS-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMRPLDPOSS table

PPURREQNITM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURREQNITM table

CALLOCRUNJEI-PERFORMANCEPERIODENDDATE table field - Billing Period of Performance End Date ▼ Description: Billing Period of Performance End Date Field Name: PERFORMANCEPERIODENDDATE Data Element: FM_PEROP_FI_HIGH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CALLOCRUNJEI table

CALLOCRUNRES-PERFORMANCEPERIODENDDATE table field - Billing Period of Performance End Date ▼ Description: Billing Period of Performance End Date Field Name: PERFORMANCEPERIODENDDATE Data Element: FM_PEROP_FI_HIGH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CALLOCRUNRES table

CMMRFQITMENH-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMRFQITMENH table

CPOSCHLINEFS-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOSCHLINEFS table

CQTNITEMCOMP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQTNITEMCOMP table

CSPQTNITEMDV-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSPQTNITEMDV table

IALLOCRUNRES-PERFORMANCEPERIODENDDATE table field - Billing Period of Performance End Date ▼ Description: Billing Period of Performance End Date Field Name: PERFORMANCEPERIODENDDATE Data Element: FM_PEROP_FI_HIGH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IALLOCRUNRES table

IFIGLACCTLIR-PERFORMANCEPERIODENDDATE table field - Billing Period of Performance End Date ▼ Description: Billing Period of Performance End Date Field Name: PERFORMANCEPERIODENDDATE Data Element: FM_PEROP_FI_HIGH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLACCTLIR table

IPRITEMAPI01-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITEMAPI01 table

IPRITEMBASIC-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITEMBASIC table

IREPPOITMENH-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREPPOITMENH table

PALLOCRUNRES-PERFORMANCEPERIODENDDATE table field - Billing Period of Performance End Date ▼ Description: Billing Period of Performance End Date Field Name: PERFORMANCEPERIODENDDATE Data Element: FM_PEROP_FI_HIGH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PALLOCRUNRES table

PPURGORDENCD-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURGORDENCD table

PURREQNITM_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURREQNITM_D table

AMMQTNITEMENH-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AMMQTNITEMENH table

CGBPRMAINTITM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGBPRMAINTITM table

CNTRLQTNITM_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNTRLQTNITM_D table

CPOSCHDLINETP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOSCHDLINETP table

CPOSUPLRCONFD-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOSUPLRCONFD table

CPURREQITEMFS-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQITEMFS table

CRFQDRFTITMPR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFQDRFTITMPR table

DRAFT_PR_ITEM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DRAFT_PR_ITEM table

ICNTRLRFQSCHL-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLRFQSCHL table

IFIJELITBROWS-PERFORMANCEPERIODENDDATE table field - Billing Period of Performance End Date ▼ Description: Billing Period of Performance End Date Field Name: PERFORMANCEPERIODENDDATE Data Element: FM_PEROP_FI_HIGH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIJELITBROWS table

IMMQTNITEMENH-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMQTNITEMENH table

IMMRFQITEMENH-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMRFQITEMENH table

IPDSCHLINEEXT-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPDSCHLINEEXT table

IPRMTHBPRITEM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRMTHBPRITEM table

IRFQDRFTITMPR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFQDRFTITMPR table

IWIPRITMDETTP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWIPRITMDETTP table

MMSRCGPITEM_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCGPITEM_D table

PALLOCRUNJEI1-PERFORMANCEPERIODENDDATE table field - Billing Period of Performance End Date ▼ Description: Billing Period of Performance End Date Field Name: PERFORMANCEPERIODENDDATE Data Element: FM_PEROP_FI_HIGH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PALLOCRUNJEI1 table

PALLOCRUNJEI2-PERFORMANCEPERIODENDDATE table field - Billing Period of Performance End Date ▼ Description: Billing Period of Performance End Date Field Name: PERFORMANCEPERIODENDDATE Data Element: FM_PEROP_FI_HIGH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PALLOCRUNJEI2 table

PMMPOFUTRSPND-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOFUTRSPND table

PMMPOSCHEACCT-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOSCHEACCT table

PMMPOSCHEDFUT-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOSCHEDFUT table

PPRJDMNDGRQTY-PERFORMANCEPERIODENDDATE table field - ▼ Description: Field Name: PERFORMANCEPERIODENDDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRJDMNDGRQTY table

RCNTRLRFQSCHL-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCNTRLRFQSCHL table

CCNTRLQTNITMTP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTRLQTNITMTP table

CNTRLRFQITEM_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNTRLRFQITEM_D table

CPOSCDLINETP_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOSCDLINETP_D table

CSRCGPROJITMVB-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRCGPROJITMVB table

CSSPPRMAINTITM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSSPPRMAINTITM table

EBAN_SSP_ITM_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBAN_SSP_ITM_D table

ICNTRLQTNITMTP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLQTNITMTP table

IMMQTNSCHEDENH-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMQTNSCHEDENH table

IMMRFQSCHEDENH-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMRFQSCHEDENH table

IPOSCHEDLINETP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPOSCHEDLINETP table

IPRJDMNDPURORD-PERFORMANCEPERIODENDDATE table field - ▼ Description: Field Name: PERFORMANCEPERIODENDDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRJDMNDPURORD table

IQTNITEMCOMPTP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQTNITEMCOMPTP table

ISRFQITEMENHWD-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRFQITEMENHWD table

IWI_PRITMDET_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWI_PRITMDET_D table

IWRKITMPRINFRE-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWRKITMPRINFRE table

MMPUR_EXT_EBAN-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_EXT_EBAN table

MMPUR_S_SP_ITM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SP_ITM table

MMQTNITEMENH_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMQTNITEMENH_D table

MMQTNITMCOMP_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMQTNITMCOMP_D table

MMRFQITEMENH_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMRFQITEMENH_D table

MMSRCGPQTNITEM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCGPQTNITEM table

PFUTSCHPOENTND-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFUTSCHPOENTND table

PMMPOSCHEDACCT-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOSCHEDACCT table

PMMPOSCHELINE1-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOSCHELINE1 table

PMNTPLGBKTCOMP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMNTPLGBKTCOMP table

RAPSPQTNITEM_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RAPSPQTNITEM_D table

APURORDSCHEDULE-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURORDSCHEDULE table

CALLOCRUNRESITM-PERFORMANCEPERIODENDDATE table field - Billing Period of Performance End Date ▼ Description: Billing Period of Performance End Date Field Name: PERFORMANCEPERIODENDDATE Data Element: FM_PEROP_FI_HIGH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CALLOCRUNRESITM table

CCONFFSCHEDLINE-PERFORMANCEPERIODENDDATE table field - Delivery Date for Item ▼ Description: Delivery Date for Item Field Name: PERFORMANCEPERIODENDDATE Data Element: EINDT_LL Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCONFFSCHEDLINE table

CMMPURREQWFLEML-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPURREQWFLEML table

CMMQTNITEMENHWD-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMQTNITEMENHWD table

ICNTRLQTNSCHDLN-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLQTNSCHDLN table

ICNTRLRFQITEMTP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLRFQITEMTP table

ICPOSCHEDLINETP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICPOSCHEDLINETP table

ICPURGDOCSLENCD-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICPURGDOCSLENCD table

IFIJOURNALENTIT-PERFORMANCEPERIODENDDATE table field - Billing Period of Performance End Date ▼ Description: Billing Period of Performance End Date Field Name: PERFORMANCEPERIODENDDATE Data Element: FM_PEROP_FI_HIGH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIJOURNALENTIT table

IMMCPOSCHDULELN-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMCPOSCHDULELN table

IMMPOSCHEDULELN-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPOSCHEDULELN table

IMMQTNITEMENHWD-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMQTNITEMENHWD table

IMMRFQITEMENHWD-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMRFQITEMENHWD table

MMPUR_CPR_S_ITM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CPR_S_ITM table

MMPUR_S_PR_EBAN-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_EBAN table

MMPUR_S_QTN_ITM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_QTN_ITM table

MMPUR_S_SPQ_ITM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SPQ_ITM table

POSCHEDLINETP_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POSCHEDLINETP_D table

PPOSCHFUTREXTND-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOSCHFUTREXTND table

PPROPENQUANCALC-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROPENQUANCALC table

PPURREQITEMMNTR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURREQITEMMNTR table

RCNTRLQTNSCHDLN-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCNTRLQTNSCHDLN table

RMMPOSCHEDULELN-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RMMPOSCHEDULELN table

CPURREQLMTITEMFS-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQLMTITEMFS table

CTRLPURREQWFLEML-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTRLPURREQWFLEML table

IMMPRGDOCSCHEDLN-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPRGDOCSCHEDLN table

IMMPRGDOCSLBASIC-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPRGDOCSLBASIC table

IMMPURORDITEMENH-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPURORDITEMENH table

IMMPURORDSLAPI01-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPURORDSLAPI01 table

IMMPURORDSLBASIC-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPURORDSLBASIC table

IMMQTNSCHEDULELN-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMQTNSCHEDULELN table

IMMRFQSCHEDULELN-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMRFQSCHEDULELN table

IPRMTHBPRITAPI01-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRMTHBPRITAPI01 table

IPROCMTHUBPRITEM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROCMTHUBPRITEM table

IPURGDOCSUPLCONF-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURGDOCSUPLCONF table

ISCHEDGAGRMTENHD-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCHEDGAGRMTENHD table

ISPQITMDHIERASSB-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPQITMDHIERASSB table

ISRFQITEMENHWD_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRFQITEMENHWD_D table

IWIPURREQNITMDET-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWIPURREQNITMDET table

IWI_PRHDRITMDT_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWI_PRHDRITMDT_D table

MMPUR_EXT_S_EKET-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_EXT_S_EKET table

MMPUR_SUPCONFD_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SUPCONFD_D table

MMPUR_S_CQTN_ITM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CQTN_ITM table

MMSRCGPQTNITEM_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMSRCGPQTNITEM_D table

PMBACKLOGSERVUNI-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMBACKLOGSERVUNI table

PPURGLTSTSCHLINE-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURGLTSTSCHLINE table

RMMPRGDOCSCHEDLN-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RMMPRGDOCSCHEDLN table

ISRFQITEMENHWD_DR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRFQITEMENHWD_DR table

MMPUR_OCI_ITM_MAP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OCI_ITM_MAP table

MMPUR_S_EXT_PR_HUB-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_PR_HUB table

MMPUR_S_SP_ITMF_EX-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SP_ITMF_EX table

TSPURCHASEREQNITEM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNITEM table

ISSRCGPROJQTNITEMTP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSRCGPROJQTNITEMTP table

MMPUR_S_EXT_LOCALPR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_LOCALPR table

MMPUR_S_PO_ITEM_SCH-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_ITEM_SCH table

MMPUR_S_SPQ_ITMF_EX-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SPQ_ITMF_EX table

MMPUR_S_SSP_PR_ITEM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_PR_ITEM table

TSPURCHASEREQNITEM_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNITEM_D table

ISSRCGPROJQTNITEMTP_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSRCGPROJQTNITEMTP_D table

MMPUR_S_PR_ODATA_ITEM-PERFORMANCEPERIODENDDATE table field - Character field of length 40 ▼ Description: Character field of length 40 Field Name: PERFORMANCEPERIODENDDATE Data Element: CHAR40 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: CHAR40 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_ODATA_ITEM table

MMPUR_S_QTN_ODATA_API-PERFORMANCEPERIODENDDATE table field - Character field of length 40 ▼ Description: Character field of length 40 Field Name: PERFORMANCEPERIODENDDATE Data Element: CHAR40 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: CHAR40 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_QTN_ODATA_API table

MMPUR_S_QTN_RAW_ODATA-PERFORMANCEPERIODENDDATE table field - Character field of length 40 ▼ Description: Character field of length 40 Field Name: PERFORMANCEPERIODENDDATE Data Element: CHAR40 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: CHAR40 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_QTN_RAW_ODATA table

TSPURCHASEREQNITEM_DR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNITEM_DR table

ISPURORDSCHEDULELINETP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURORDSCHEDULELINETP table

ISSRCGPROJQTNITEMTP_DR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSRCGPROJQTNITEMTP_DR table

MMPUR_S_PR_RPL_DETAILS-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_RPL_DETAILS table

ISSOURCINGPROJECTITEMTP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSOURCINGPROJECTITEMTP table

MMPUR_PREQUISITION_ITEM-PERFORMANCEPERIODENDDATE table field - Field of type DATS ▼ Description: Field of type DATS Field Name: PERFORMANCEPERIODENDDATE Data Element: DATS Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PREQUISITION_ITEM table

MMPUR_S_LCL_PO_ITEM_SCH-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_LCL_PO_ITEM_SCH table

MMPUR_S_PO_SCHED_CHANGE-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_SCHED_CHANGE table

MMPUR_S_SSPPR_ITM_CHECK-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSPPR_ITM_CHECK table

FINS_CFIN_S_AV_PO_EX_SCH-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: FINS_CFIN_AV_SERV_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_SCH table

ISPURORDSCHEDULELINETP_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURORDSCHEDULELINETP_D table

MMPUR_CENTRAL_PURCHASING-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table

MMPUR_S_EXTR_PR_DATA_HUB-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXTR_PR_DATA_HUB table

MMPUR_S_ITEM_ACCOUNT_INT-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_ITEM_ACCOUNT_INT table

MMPUR_S_SSPPR_ITM_CHANGE-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSPPR_ITM_CHANGE table

ISPURORDSCHEDULELINETP_DR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURORDSCHEDULELINETP_DR table

ISSERVICEENTRYSHEETITEMTP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSERVICEENTRYSHEETITEMTP table

ISSOURCINGPROJECTITEMTP_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSOURCINGPROJECTITEMTP_D table

ISSUPLRQUOTATIONITEMENHWD-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLRQUOTATIONITEMENHWD table

MMPUR_S_EXTR_LOCALPR_DATA-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXTR_LOCALPR_DATA table

FINS_CFIN_S_AV_PO_EX_SCH_K-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: FINS_CFIN_AV_SERV_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_SCH_K table

ISSOURCINGPROJECTITEMTP_DR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSOURCINGPROJECTITEMTP_DR table

MMPUR_PPR_S_RFQ_DRAFTS_ITM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PPR_S_RFQ_DRAFTS_ITM table

FINS_CFIN_S_AV_PO_EX_SCH_DB-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: FINS_CFIN_AV_SERV_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_SCH_DB table

ISSERVICEENTRYSHEETITEMTP_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSERVICEENTRYSHEETITEMTP_D table

ISSUPLRQUOTATIONITEMENHWD_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLRQUOTATIONITEMENHWD_D table

MMPUR_OCI_ITM_TO_DRAFT_ITEM-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OCI_ITM_TO_DRAFT_ITEM table

MMPUR_S_EXT_LCL_PO_ITEM_SCH-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_LCL_PO_ITEM_SCH table

ISPURCHASEREQUISITIONITEM_WD-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEREQUISITIONITEM_WD table

ISSERVICEENTRYSHEETITEMTP_DR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSERVICEENTRYSHEETITEMTP_DR table

ISSUPLRQUOTATIONITEMENHWD_DR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLRQUOTATIONITEMENHWD_DR table

ISCNTRLPURORDERSCHEDULELINETP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURORDERSCHEDULELINETP table

ISSUPLRQUOTATIONITEMCOMPARETP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLRQUOTATIONITEMCOMPARETP table

ISWORKITEMPURREQNITEMDETAILTP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISWORKITEMPURREQNITEMDETAILTP table

ISCENTRALREQFORQUOTATIONITEMTP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALREQFORQUOTATIONITEMTP table

ISCENTRALREQFORQUOTATIONITEM_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALREQFORQUOTATIONITEM_D table

ISCENTRALREQFORQUOTATIONITE_DR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALREQFORQUOTATIONITE_DR table

ISCNTRLPURORDERSCHEDULELINET_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURORDERSCHEDULELINET_D table

ISCNTRLPURORDERSCHEDULELINE_DR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURORDERSCHEDULELINE_DR table

ISCNTRLSUPPLIERQUOTATIONITEMTP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLSUPPLIERQUOTATIONITEMTP table

ISCNTRLSUPPLIERQUOTATIONITEM_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLSUPPLIERQUOTATIONITEM_D table

ISCNTRLSUPPLIERQUOTATIONITE_DR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLSUPPLIERQUOTATIONITE_DR table

ISPURCHASEREQUISITIONITEM_WD_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEREQUISITIONITEM_WD_D table

ISPURCHASEREQUISITIONITEM_W_DR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEREQUISITIONITEM_W_DR table

ISSUPLRQUOTATIONITEMCOMPARET_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLRQUOTATIONITEMCOMPARET_D table

ISSUPLRQUOTATIONITEMCOMPARE_DR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLRQUOTATIONITEMCOMPARE_DR table

ISWORKITEMPURREQNITEMDETAILT_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISWORKITEMPURREQNITEMDETAILT_D table

ISWORKITEMPURREQNITEMDETAIL_DR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISWORKITEMPURREQNITEMDETAIL_DR table

ISWRKITMPURREQNHDRITEMDETAILTP-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISWRKITMPURREQNHDRITEMDETAILTP table

ISWRKITMPURREQNHDRITEMDETAIL_D-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISWRKITMPURREQNHDRITEMDETAIL_D table

ISWRKITMPURREQNHDRITEMDETAI_DR-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISWRKITMPURREQNHDRITEMDETAI_DR table

MMPUR_S_PURCHASEORDERSCHEDLINE-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance ▼ Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PURCHASEORDERSCHEDLINE table