SAP REPTEXT field - Heading details in SAP

Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211

Details

DD03M-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD03M table

DD03P-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD03P table

DD27M-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD27M table

DD03NP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD03NP table

DD03VT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD03VT table

DD04VVT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD04VVT table

INFO_DTELT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INFO_DTELT table

INFO_TABLV-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INFO_TABLV table

INFO_UENAT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INFO_UENAT table

H_BIC_FIELDS-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP H_BIC_FIELDS table

TXW_LANG_TEXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TXW_LANG_TEXT table

COLLSTRGYRULES-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COLLSTRGYRULES table

TKEBO_YS_FIELD_EXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TKEBO_YS_FIELD_EXT table

DD04D-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD04D table

DD04T-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD04T table

DD04V-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD04V table

DD27P-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD27P table

DDFTX-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DDFTX table

DFIES-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFIES table

DIO04-REPTEXT table field - DDIN: Field output flag ▼ Description: DDIN: Field output flag Field Name: REPTEXT Data Element: OUTPUTFLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: OUTPUTFLAG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIO04 table

DIP04-REPTEXT table field - R/3 DD: column heading ▼ Description: R/3 DD: column heading Field Name: REPTEXT Data Element: DIP0412 Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: SELTXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIP04 table

KDFIT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP KDFIT table

KDLIT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP KDLIT table

KGALK-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP KGALK table

MCS01-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCS01 table

MCS03-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCS03 table

MCS04-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCS04 table

MCS05-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCS05 table

MCS07-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCS07 table

RKAFT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RKAFT table

T770U-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP T770U table

TCNTX-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TCNTX table

TCOTX-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TCOTX table

TDG22-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDG22 table

TF0FP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TF0FP table

UPCCD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UPCCD table

DD03NE-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD03NE table

DD03PE-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD03PE table

DD04TV-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD04TV table

DD04VD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD04VD table

KPP0DD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP KPP0DD table

TCOTXM-REPTEXT table field - ▼ Description: Field Name: REPTEXT Data Element: Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TCOTXM table

XDD04V-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP XDD04V table

BAPIF4E-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIF4E table

DD03P_D-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD03P_D table

E1DD04T-REPTEXT table field - ▼ Description: Field Name: REPTEXT Data Element: Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E1DD04T table

E1MC1KT-REPTEXT table field - ▼ Description: Field Name: REPTEXT Data Element: Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E1MC1KT table

IKEYFTS-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IKEYFTS table

LIST_DE-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LIST_DE table

MCDDOWN-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCDDOWN table

QTINFOT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QTINFOT table

TBIER_S-REPTEXT table field - Character field, length 70 ▼ Description: Character field, length 70 Field Name: REPTEXT Data Element: CHAR70 Data Type: CHAR length (Dec): 70(0) Check table: Conversion Routine: Domain Name: CHAR70 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TBIER_S table

TCNTX_I-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TCNTX_I table

TCOTX_I-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TCOTX_I table

BAPISHLP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPISHLP table

CRMDD04T-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMDD04T table

DEXDD03P-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DEXDD03P table

EXTDFIES-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EXTDFIES table

F4MCHLP2-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP F4MCHLP2 table

F4MCHLP3-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP F4MCHLP3 table

IQIFIELD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQIFIELD table

IQQFIELD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQQFIELD table

LIST_DLF-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LIST_DLF table

LIST_DMF-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LIST_DMF table

LIST_DOF-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LIST_DOF table

LIST_DSF-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LIST_DSF table

LIST_DTF-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LIST_DTF table

LIST_DVF-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LIST_DVF table

LVC_S_DG-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LVC_S_DG table

NTAB_CMP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NTAB_CMP table

SDME_SVF-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDME_SVF table

T8PL01DD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP T8PL01DD table

TXW_META-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TXW_META table

UGMD2006-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UGMD2006 table

UGMD2157-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UGMD2157 table

UGMD2257-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UGMD2257 table

VCIDD04T-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VCIDD04T table

VWRPLTAF-REPTEXT table field - Column heading (only fill directly in exceptional cases) ▼ Description: Column heading (only fill directly in exceptional cases) Field Name: REPTEXT Data Element: REPTXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VWRPLTAF table

VXDD04TV-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VXDD04TV table

AQSEXDBFI-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AQSEXDBFI table

CAT_FINFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CAT_FINFO table

CXPS_SHOW-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CXPS_SHOW table

CYFELDTAB-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CYFELDTAB table

DD04V_OLD-REPTEXT table field - ▼ Description: Field Name: REPTEXT Data Element: Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD04V_OLD table

FIELDINFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FIELDINFO table

MASSDFIES-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MASSDFIES table

TCNTX_SQL-REPTEXT table field - ▼ Description: Field Name: REPTEXT Data Element: Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TCNTX_SQL table

TXPDREPST-REPTEXT table field - Description ▼ Description: Description Field Name: REPTEXT Data Element: CN_TXT Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: TEXT40 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TXPDREPST table

TXW_META4-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TXW_META4 table

VIMNAMTAB-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIMNAMTAB table

VWRPLTAFV-REPTEXT table field - Column heading (only fill directly in exceptional cases) ▼ Description: Column heading (only fill directly in exceptional cases) Field Name: REPTEXT Data Element: REPTXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VWRPLTAFV table

ALV_S_FCAT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ALV_S_FCAT table

BAL_S_FLDS-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAL_S_FLDS table

DCDTEDATTR-REPTEXT table field - DD: truth value ▼ Description: DD: truth value Field Name: REPTEXT Data Element: DDBOOL_D Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: DDBOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DCDTEDATTR table

DCDTTXATTR-REPTEXT table field - DD: truth value ▼ Description: DD: truth value Field Name: REPTEXT Data Element: DDBOOL_D Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: DDBOOL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DCDTTXATTR table

DD27VVTSTR-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DD27VVTSTR table

DDFIELDTAB-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DDFIELDTAB table

DGV_TDG21B-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DGV_TDG21B table

GFC_CLSFLD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GFC_CLSFLD table

GFC_DICFLD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GFC_DICFLD table

IQFIELD_OU-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQFIELD_OU table

J_7LKKUMRK-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP J_7LKKUMRK table

LIST_COL_C-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LIST_COL_C table

LVC_S_FCAT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LVC_S_FCAT table

LVC_S_INFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LVC_S_INFO table

NTAB_CMP30-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NTAB_CMP30 table

RHTEXT_TAB-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RHTEXT_TAB table

SCPRVALUES-REPTEXT table field - Short text of table field ▼ Description: Short text of table field Field Name: REPTEXT Data Element: SCPR_FTEXT Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: SCRTEXT_L MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCPRVALUES table

SCPR_DESCR-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCPR_DESCR table

SCPR_RECRD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCPR_RECRD table

SCR_DFIELD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCR_DFIELD table

SDME_SFTXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDME_SFTXT table

SNMETADATA-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SNMETADATA table

SQLTSELFLD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SQLTSELFLD table

TCOMPREPST-REPTEXT table field - Description ▼ Description: Description Field Name: REPTEXT Data Element: CN_TXT Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: TEXT40 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TCOMPREPST table

TXW_V_FLDS-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TXW_V_FLDS table

UPP_YS_KDD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UPP_YS_KDD table

VIMNAMTAB3-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIMNAMTAB3 table

VIMNAMTABC-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIMNAMTABC table

VSDD040000-REPTEXT table field - ▼ Description: Field Name: REPTEXT Data Element: Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VSDD040000 table

VSDD040001-REPTEXT table field - ▼ Description: Field Name: REPTEXT Data Element: Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VSDD040001 table

VXDD040000-REPTEXT table field - ▼ Description: Field Name: REPTEXT Data Element: Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VXDD040000 table

VXDD040001-REPTEXT table field - ▼ Description: Field Name: REPTEXT Data Element: Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VXDD040001 table

VXDD04VOLD-REPTEXT table field - ▼ Description: Field Name: REPTEXT Data Element: Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VXDD04VOLD table

V_TXPDREPS-REPTEXT table field - Description ▼ Description: Description Field Name: REPTEXT Data Element: CN_TXT Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: TEXT40 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_TXPDREPS table

V_UGMD2257-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_UGMD2257 table

CCCNTAB_CMP-REPTEXT table field - Proxy Data Element (generated) ▼ Description: Proxy Data Element (generated) Field Name: REPTEXT Data Element: CCCCHAR55 Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCCNTAB_CMP table

CXPS_FIELDS-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CXPS_FIELDS table

MDG_MDF2006-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_MDF2006 table

TXW_VW_META-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TXW_VW_META table

UCD_S_FPROP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UCD_S_FPROP table

UGX_S_FPROP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UGX_S_FPROP table

V_TCOMPREPS-REPTEXT table field - Description ▼ Description: Description Field Name: REPTEXT Data Element: CN_TXT Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: TEXT40 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_TCOMPREPS table

CCGLWBV_STSC-REPTEXT table field - Field Label Heading ▼ Description: Field Label Heading Field Name: REPTEXT Data Element: CBGLE_WB_REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCGLWBV_STSC table

CCGLWBV_STSM-REPTEXT table field - Field Label Heading ▼ Description: Field Label Heading Field Name: REPTEXT Data Element: CBGLE_WB_REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCGLWBV_STSM table

CCGLWBV_TSOC-REPTEXT table field - Field Label Heading ▼ Description: Field Label Heading Field Name: REPTEXT Data Element: CBGLE_WB_REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCGLWBV_TSOC table

CCGLWBV_TSOM-REPTEXT table field - Field Label Heading ▼ Description: Field Label Heading Field Name: REPTEXT Data Element: CBGLE_WB_REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCGLWBV_TSOM table

DMC_DD03P_30-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DMC_DD03P_30 table

FC00_S_FPROP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FC00_S_FPROP table

FIELDINFO_ST-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FIELDINFO_ST table

FINX_S_FINFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINX_S_FINFO table

FMKBO_FIELDS-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMKBO_FIELDS table

FOX0_FIELD_S-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FOX0_FIELD_S table

MDG_GN_TEXTS-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_GN_TEXTS table

SIW_STR_DTEL-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SIW_STR_DTEL table

TXI_METADATA-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TXI_METADATA table

TXW_VDT_DESC-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TXW_VDT_DESC table

TXW_VDT_DESC-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TXW_VDT_DESC table

TXX_VDT_DESC-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TXX_VDT_DESC table

UGMD_S_FATTR-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UGMD_S_FATTR table

UGMD_S_FPROP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UGMD_S_FPROP table

USMD_S_FPROP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP USMD_S_FPROP table

/PM0/ABUASHLP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PM0/ABUASHLP table

/SAPAPO/MCS01-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/MCS01 table

/SAPAPO/MCS04-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: /SAPAPO/REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: /SAPAPO/REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/MCS04 table

/SDF/CMODFIES-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SDF/CMODFIES table

ALVXML_S_COL2-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ALVXML_S_COL2 table

CCCVIMNAMTABC-REPTEXT table field - Proxy Data Element (generated) ▼ Description: Proxy Data Element (generated) Field Name: REPTEXT Data Element: CCCCHAR55 Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCCVIMNAMTABC table

COCF_S_LAYOUT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COCF_S_LAYOUT table

FCML_FIELDTAB-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCML_FIELDTAB table

FINB_GN_TEXTS-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINB_GN_TEXTS table

FINB_MD_S_TXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINB_MD_S_TXT table

FKK_EXTR_DD03-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_EXTR_DD03 table

TXBC_METADATA-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TXBC_METADATA table

TXX_META_DATA-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TXX_META_DATA table

UCL_S_LP_FFIX-REPTEXT table field - List Processor: Heading ▼ Description: List Processor: Heading Field Name: REPTEXT Data Element: UC_LP_REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: UC_LP_REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UCL_S_LP_FFIX table

UPB_YS_FC_TXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UPB_YS_FC_TXT table

/PM0/ABU_PSHLP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PM0/ABU_PSHLP table

ALV_S_FCAT_DB2-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ALV_S_FCAT_DB2 table

CCGLC_WBC_STSC-REPTEXT table field - Field Label Heading ▼ Description: Field Label Heading Field Name: REPTEXT Data Element: CBGLE_WB_REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCGLC_WBC_STSC table

CCGLC_WBC_TSOC-REPTEXT table field - Field Label Heading ▼ Description: Field Label Heading Field Name: REPTEXT Data Element: CBGLE_WB_REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCGLC_WBC_TSOC table

CML_MIG_BUFFER-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CML_MIG_BUFFER table

CRMV_PRT_LABEL-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMV_PRT_LABEL table

FIELD_TEXTS_ST-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FIELD_TEXTS_ST table

GFD_FIELD_INFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GFD_FIELD_INFO table

LVC_S_FCAT_DB2-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LVC_S_FCAT_DB2 table

LVC_S_INFO_WAO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LVC_S_INFO_WAO table

RHTEXT_INFOTAB-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RHTEXT_INFOTAB table

TCO_FIELD_TEXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TCO_FIELD_TEXT table

TIM_TMW_S_FCAT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TIM_TMW_S_FCAT table

TXW_LANGU_TEXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TXW_LANGU_TEXT table

UCL_S_LP_FUSED-REPTEXT table field - List Processor: Heading ▼ Description: List Processor: Heading Field Name: REPTEXT Data Element: UC_LP_REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: UC_LP_REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UCL_S_LP_FUSED table

UGMD_S_REPTEXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UGMD_S_REPTEXT table

WST_ATTR_DFIES-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WST_ATTR_DFIES table

/AIF/DD04V_INFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /AIF/DD04V_INFO table

/PM0/3FR_FIELDT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PM0/3FR_FIELDT table

/SAPAPO/MCDDOWN-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: /SAPAPO/REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: /SAPAPO/REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/MCDDOWN table

/SAPAPO/QTINFOT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/QTINFOT table

ACE_PARAM_FIELD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACE_PARAM_FIELD table

CRMV_PRT_LABELC-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMV_PRT_LABELC table

ETXML_DFIES_EXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ETXML_DFIES_EXT table

FC00_S_LVC_FCAT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FC00_S_LVC_FCAT table

FINB_MD_S_FPROP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINB_MD_S_FPROP table

FPB_S_FIELDLIST-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FPB_S_FIELDLIST table

MDG_MDF_S_FATTR-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_MDF_S_FATTR table

MDG_MDF_S_FPROP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_MDF_S_FPROP table

MEREP_DDIC_INFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEREP_DDIC_INFO table

ROIRC_CONDITION-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ROIRC_CONDITION table

UAB_S_FIELDINFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UAB_S_FIELDINFO table

UCD_S_FPROP_EXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UCD_S_FPROP_EXT table

UCU_S_SEL_PARAM-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UCU_S_SEL_PARAM table

UGMD_S_ROLE_TXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UGMD_S_ROLE_TXT table

WRMA_S_GENERATE-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRMA_S_GENERATE table

/IPRO/S_VAR_TYPE-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /IPRO/S_VAR_TYPE table

/SCMB/PRM_DICSTR-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/PRM_DICSTR table

AUTH_FLDINFO_TMP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AUTH_FLDINFO_TMP table

CNVCMIS_A_1_DTEL-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNVCMIS_A_1_DTEL table

CRMC_PRT_LABEL_T-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMC_PRT_LABEL_T table

CRMC_PRT_LABLC_T-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMC_PRT_LABLC_T table

CRMS_BSDM_DFIELD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS_BSDM_DFIELD table

DML_S_FIELD_INFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DML_S_FIELD_INFO table

EWASGRIDMASKITEM-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWASGRIDMASKITEM table

FOX0_SPLIT_KEY_S-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FOX0_SPLIT_KEY_S table

HRFPM_WD_REPORTS-REPTEXT table field - WD Report Text ▼ Description: WD Report Text Field Name: REPTEXT Data Element: HRFPM_WD_REPTXT Data Type: CHAR length (Dec): 100(0) Check table: Conversion Routine: Domain Name: HRFPM_WD_REPTXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRFPM_WD_REPORTS table

IWP_S_STRCMETDAT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWP_S_STRCMETDAT table

MASSSEARCHFIELDS-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MASSSEARCHFIELDS table

SATR_HC_CONTENTS-REPTEXT table field - SATR: Object Text for TRAN, PROG, or FUNC ▼ Description: SATR: Object Text for TRAN, PROG, or FUNC Field Name: REPTEXT Data Element: SATR_HC_OBJTEXT Data Type: CHAR length (Dec): 70(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SATR_HC_CONTENTS table

TDMODEL_FIELDTXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDMODEL_FIELDTXT table

UAB_S_COLUMN_RFC-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UAB_S_COLUMN_RFC table

UCM_S_FPROP_TECH-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UCM_S_FPROP_TECH table

UGMD_S_DFIES_TXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UGMD_S_DFIES_TXT table

UGMD_S_FIELDINFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UGMD_S_FIELDINFO table

UGMD_S_FPROP_BUF-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UGMD_S_FPROP_BUF table

UGMD_S_FPROP_TXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UGMD_S_FPROP_TXT table

USMD_S_FPROP_EXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP USMD_S_FPROP_EXT table

V_TDMODEL_FLDTXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_TDMODEL_FLDTXT table

/IPRO/S_UI_COLUMN-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /IPRO/S_UI_COLUMN table

/UI2/S_FIELD_INFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /UI2/S_FIELD_INFO table

CATSXT_COMPARE_WA-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CATSXT_COMPARE_WA table

IRW_LTTXIMETADATA-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRW_LTTXIMETADATA table

MDG_MDF_S_REPTEXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_MDF_S_REPTEXT table

RMODEL_FIELDTEXTS-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RMODEL_FIELDTEXTS table

SIWP_S_STRCMETDAT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SIWP_S_STRCMETDAT table

SIW_STR_DTEL_INFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SIW_STR_DTEL_INFO table

SIW_STR_DTEL_META-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SIW_STR_DTEL_META table

TDS_SD_PRODH_INFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_PRODH_INFO table

TXI_METADATA_TEXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TXI_METADATA_TEXT table

UCM_S_BDCHK_FPROP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UCM_S_BDCHK_FPROP table

UCM_S_DBS_REPTEXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UCM_S_DBS_REPTEXT table

UGMD_SCDT_S_FPROP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UGMD_SCDT_S_FPROP table

/SAPAPO/CDPS_MCS01-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/CDPS_MCS01 table

CACS_BR_S_FLD_SHLP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACS_BR_S_FLD_SHLP table

CNVCDMCUCIA_DD04VD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNVCDMCUCIA_DD04VD table

CNVCDOPUCIA_DD04VD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNVCDOPUCIA_DD04VD table

COMS_GOX_FIELDINFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COMS_GOX_FIELDINFO table

COXML_S_FIELD_LIST-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COXML_S_FIELD_LIST table

EHPRCS_SIM_FCT_SET-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCS_SIM_FCT_SET table

FINB_MD_S_EXTERNAL-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINB_MD_S_EXTERNAL table

ISUS_UMC_DDIC_TEXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUS_UMC_DDIC_TEXT table

MDG_GN_DTEL_SOURCE-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_GN_DTEL_SOURCE table

MDG_MDF_S_ROLE_TXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_MDF_S_ROLE_TXT table

RMSAS_STD_FIELDCAT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RMSAS_STD_FIELDCAT table

RPM_TS_TASK_LABELS-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPM_TS_TASK_LABELS table

TDS_GAF_EWB_PREDEF-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_GAF_EWB_PREDEF table

UCL_S_LOG_CHAR_DEF-REPTEXT table field - List Processor: Heading ▼ Description: List Processor: Heading Field Name: REPTEXT Data Element: UC_LP_REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: UC_LP_REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UCL_S_LOG_CHAR_DEF table

UCL_S_LOG_KFIG_DEF-REPTEXT table field - List Processor: Heading ▼ Description: List Processor: Heading Field Name: REPTEXT Data Element: UC_LP_REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: UC_LP_REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UCL_S_LOG_KFIG_DEF table

UCL_S_LP_ADD_FINFO-REPTEXT table field - List Processor: Heading ▼ Description: List Processor: Heading Field Name: REPTEXT Data Element: UC_LP_REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: UC_LP_REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UCL_S_LP_ADD_FINFO table

UGMD_S_PRINT_FDISP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UGMD_S_PRINT_FDISP table

WRMA_S_GENERATE_PI-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRMA_S_GENERATE_PI table

/IPRO/S_UI_VARIABLE-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /IPRO/S_UI_VARIABLE table

CRMS_PRT_TEXT_LABEL-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS_PRT_TEXT_LABEL table

FINB_GN_DTEL_SOURCE-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINB_GN_DTEL_SOURCE table

FMKU_S_LABEL_COLUMN-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMKU_S_LABEL_COLUMN table

HRPAO_S_ORGFAVORITE-REPTEXT table field - ▼ Description: Field Name: REPTEXT Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRPAO_S_ORGFAVORITE table

MDG_MDF_S_DFIES_TXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_MDF_S_DFIES_TXT table

MDG_MDF_S_FIELDINFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_MDF_S_FIELDINFO table

MDG_MDF_S_FPROP_BUF-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_MDF_S_FPROP_BUF table

MDG_MDF_S_FPROP_TXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_MDF_S_FPROP_TXT table

TKEBO_S_FIELD_DESCR-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TKEBO_S_FIELD_DESCR table

UAB_S_FIELDINFO_INT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UAB_S_FIELDINFO_INT table

UGMD_S_PROPERTY_TXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UGMD_S_PROPERTY_TXT table

/ACCGO/CMN_S_DTEL_OP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ACCGO/CMN_S_DTEL_OP table

/RPM/TS_FIELDS_DESCR-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /RPM/TS_FIELDS_DESCR table

/SCF/S_FIELDPRMDD04V-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCF/S_FIELDPRMDD04V table

/SCMB/DF_DESCRIPTION-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/DF_DESCRIPTION table

/SDF/RBE_TABL_FIELDS-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SDF/RBE_TABL_FIELDS table

EHSBS_API_VAI_LAYOUT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHSBS_API_VAI_LAYOUT table

MDG_YS_META_DESCRIPT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_YS_META_DESCRIPT table

RMSAS_API_VAI_LAYOUT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RMSAS_API_VAI_LAYOUT table

RMSTS_DDIC_DEF_LANGU-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RMSTS_DDIC_DEF_LANGU table

UGMD_S_FIELD_REPTEXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UGMD_S_FIELD_REPTEXT table

/EACC/MP_S_FIELDTEXTS-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /EACC/MP_S_FIELDTEXTS table

/SCMB/PRM_DETAILS_STR-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/PRM_DETAILS_STR table

COMT_CLEAR_VALUE_DESC-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COMT_CLEAR_VALUE_DESC table

CRMT_REC_DWP_OBJ_INFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_REC_DWP_OBJ_INFO table

CRMT_REC_DWP_SCHEDULE-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_REC_DWP_SCHEDULE table

EWASGRIDMASKITEMORDER-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWASGRIDMASKITEMORDER table

FINB_YS_META_DESCRIPT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINB_YS_META_DESCRIPT table

IDREPFW_STR_NODE_DATA-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDREPFW_STR_NODE_DATA table

IRW_LTTXIMETADATATEXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRW_LTTXIMETADATATEXT table

IWP_S_STRCMETDAT_TEXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWP_S_STRCMETDAT_TEXT table

MDG_MDF_S_PRINT_FDISP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_MDF_S_PRINT_FDISP table

RMSTS_DDIC_DEFINITION-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RMSTS_DDIC_DEFINITION table

RPM_TS_PROJECT_LABELS-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPM_TS_PROJECT_LABELS table

SATR_LIST_OF_CONTENTS-REPTEXT table field - Report title ▼ Description: Report title Field Name: REPTEXT Data Element: REPTI Data Type: CHAR length (Dec): 70(0) Check table: Conversion Routine: Domain Name: REPTI MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SATR_LIST_OF_CONTENTS table

UCM_S_BDCHK_FPROP_GUI-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UCM_S_BDCHK_FPROP_GUI table

UCM_S_DBS_GUI_REPTEXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UCM_S_DBS_GUI_REPTEXT table

/IWBEP/S_SHLP_DDFIELDS-REPTEXT table field - ▼ Description: Field Name: REPTEXT Data Element: Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /IWBEP/S_SHLP_DDFIELDS table

AXTS_RUNTIME_EXT_FIELD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AXTS_RUNTIME_EXT_FIELD table

CRMT_BSP_DESIG_DFIES_S-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_BSP_DESIG_DFIES_S table

EPIC_S_CB_DFIES_EXTEND-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EPIC_S_CB_DFIES_EXTEND table

FINSS_ONE_ALLOC_IKGALK-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINSS_ONE_ALLOC_IKGALK table

MDG_BS_MAT_S_ATTR_INFO-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_BS_MAT_S_ATTR_INFO table

MDG_MDF_S_PROPERTY_TXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_MDF_S_PROPERTY_TXT table

SIWP_S_STRCMETDAT_TEXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SIWP_S_STRCMETDAT_TEXT table

/FTI/S_BADI_PROPOSAL_UI-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /FTI/S_BADI_PROPOSAL_UI table

/RPM/TS_SLH_FIELD_DESCR-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /RPM/TS_SLH_FIELD_DESCR table

EWASGRIDMASKITEMDEFAULT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWASGRIDMASKITEMDEFAULT table

MDG_MDF_S_FIELD_REPTEXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_MDF_S_FIELD_REPTEXT table

SRAL_ALV_RECORDER_FIELD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SRAL_ALV_RECORDER_FIELD table

/FTI/S_REG_PROPOSAL_UI_I-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /FTI/S_REG_PROPOSAL_UI_I table

/SYCLO/CORE_KEY_INFO_STR-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/CORE_KEY_INFO_STR table

CNV_PE_S_SHLP_FIELDDESCR-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNV_PE_S_SHLP_FIELDDESCR table

EAML_S_EVT_OTYPE_FCAT_FL-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAML_S_EVT_OTYPE_FCAT_FL table

EWASGRIDMASKFIELDCATITEM-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWASGRIDMASKFIELDCATITEM table

IDFI_MT940_STR_NODE_DATA-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDFI_MT940_STR_NODE_DATA table

INM_TS_FIELD_DESCRIPTION-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INM_TS_FIELD_DESCRIPTION table

PHIN_S_FIELDNAME_REPTEXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PHIN_S_FIELDNAME_REPTEXT table

UCF_S_MDOC_ADDCHAR_FPROP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UCF_S_MDOC_ADDCHAR_FPROP table

/BCV/S_UIF_PDF_FIELD_LIST-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /BCV/S_UIF_PDF_FIELD_LIST table

/IWBEP/S_HELP_VALUES_DESC-REPTEXT table field - ▼ Description: Field Name: REPTEXT Data Element: Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /IWBEP/S_HELP_VALUES_DESC table

/PLMB/S_RFO_ARF_COL_TEXTS-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMB/S_RFO_ARF_COL_TEXTS table

/SAPPO/STR_FA_FIELDS_FCAT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/STR_FA_FIELDS_FCAT table

/SDF/RBE_NATSQL_SDD_FIELD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SDF/RBE_NATSQL_SDD_FIELD table

EWASGRIDMASKITEMORDERITEM-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWASGRIDMASKITEMORDERITEM table

EWAS_CCOC_COPADATA_EXT_DP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWAS_CCOC_COPADATA_EXT_DP table

SATR_LIST_OF_CONTENTS_ERR-REPTEXT table field - Report title ▼ Description: Report title Field Name: REPTEXT Data Element: REPTI Data Type: CHAR length (Dec): 70(0) Check table: Conversion Routine: Domain Name: REPTI MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SATR_LIST_OF_CONTENTS_ERR table

SATR_LIST_OF_CONTENTS_OUT-REPTEXT table field - Report title ▼ Description: Report title Field Name: REPTEXT Data Element: REPTI Data Type: CHAR length (Dec): 70(0) Check table: Conversion Routine: Domain Name: REPTI MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SATR_LIST_OF_CONTENTS_OUT table

SXCO_S_GEN_DTEL_BLUEPRINT-REPTEXT table field - Comment ▼ Description: Comment Field Name: REPTEXT Data Element: CHAR50 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: TEXT50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SXCO_S_GEN_DTEL_BLUEPRINT table

UCL_S_LOG_FFIX_PROPERTIES-REPTEXT table field - List Processor: Heading ▼ Description: List Processor: Heading Field Name: REPTEXT Data Element: UC_LP_REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: UC_LP_REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UCL_S_LOG_FFIX_PROPERTIES table

/PM0/ABCAIBCCLASSIFIC_ATTR-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PM0/ABCAIBCCLASSIFIC_ATTR table

/PM0/ABCAIBCCLASSIFIC_MARK-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PM0/ABCAIBCCLASSIFIC_MARK table

/PM0/ABC_IBC_ATTR_ALV_ATTR-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PM0/ABC_IBC_ATTR_ALV_ATTR table

/PM0/ABC_IBC_ATTR_ALV_MARK-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PM0/ABC_IBC_ATTR_ALV_MARK table

/RPM/TS_FIELDS_DESCRIPTION-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /RPM/TS_FIELDS_DESCRIPTION table

/SAPPO/STR_FA_FIELDS_DFIES-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/STR_FA_FIELDS_DFIES table

CCGLS_WB_TAB_SCRPROP_D_DEF-REPTEXT table field - Field Label Heading ▼ Description: Field Label Heading Field Name: REPTEXT Data Element: CBGLE_WB_REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCGLS_WB_TAB_SCRPROP_D_DEF table

CNV_ADT_DP_20551_S_OBJTEXT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNV_ADT_DP_20551_S_OBJTEXT table

EWASGRIDMASKITEMORDERWEIGH-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWASGRIDMASKITEMORDERWEIGH table

RPM_TS_CUSTOM_FIELDS_DESCR-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPM_TS_CUSTOM_FIELDS_DESCR table

RPM_TS_OBJLNK_FIELDS_DESCR-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPM_TS_OBJLNK_FIELDS_DESCR table

/CPD/PWS_RCBS_FIELD_CATALOG-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /CPD/PWS_RCBS_FIELD_CATALOG table

/GC1/STR_DDIC_DTEL_METADATA-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /GC1/STR_DDIC_DTEL_METADATA table

HRALEOX_HRALXSYNC_GRID_FCAT-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRALEOX_HRALXSYNC_GRID_FCAT table

MDG_MDF_S_FIELDINFO_LANGDEP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_MDF_S_FIELDINFO_LANGDEP table

CCGLS_WB_SUBTAB_SCRPROP_D_DEF-REPTEXT table field - Field Label Heading ▼ Description: Field Label Heading Field Name: REPTEXT Data Element: CBGLE_WB_REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCGLS_WB_SUBTAB_SCRPROP_D_DEF table

COM_PRD_TS_LH_KEY_COMPNTS_MAP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COM_PRD_TS_LH_KEY_COMPNTS_MAP table

COM_PRD_TS_LH_KEY_COMPNTS_MAP-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COM_PRD_TS_LH_KEY_COMPNTS_MAP table

CRMT_REC_DWP_OBJ_INFO_WITH_ID-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_REC_DWP_OBJ_INFO_WITH_ID table

CRMT_REC_DWP_TIMESTREAMHEADER-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_REC_DWP_TIMESTREAMHEADER table

/CPD/PWS_WSS_OBJ_FIELD_CATALOG-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /CPD/PWS_WSS_OBJ_FIELD_CATALOG table

FAGL_S_SEL_VIEW_FIELDS_VISIBLE-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAGL_S_SEL_VIEW_FIELDS_VISIBLE table

MDG_BS_MAT_S_ATTRINFO_FROM_FLD-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_BS_MAT_S_ATTRINFO_FROM_FLD table

RPM_TS_OBJLNK_FIELDS_OLP_DESCR-REPTEXT table field - Heading ▼ Description: Heading Field Name: REPTEXT Data Element: REPTEXT Data Type: CHAR length (Dec): 55(0) Check table: Conversion Routine: Domain Name: REPTEXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPM_TS_OBJLNK_FIELDS_OLP_DESCR table

SXCO_S_GEN_DTEL_BP_FIELD_LABEL-REPTEXT table field - Comment ▼ Description: Comment Field Name: REPTEXT Data Element: CHAR50 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: TEXT50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SXCO_S_GEN_DTEL_BP_FIELD_LABEL table