Details |
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SDRO-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDRO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOQV-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_CO Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOQV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBPFP-SALESDOCUMENTITEM table field - Sales Document Order
▼
Description: Sales Document Order Field Name: SALESDOCUMENTITEM Data Element: /CPD/PWS_RCB_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPFP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBPSD-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPSD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPOQV-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_CO Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPOQV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDVB-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDVB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMPSO-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPSO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMPDMR-SALESDOCUMENTITEM table field - Commercial Project Sales Order Item
▼
Description: Commercial Project Sales Order Item Field Name: SALESDOCUMENTITEM Data Element: /CPD/CPM_SOITEM Data Type: CHAR length (Dec): 17(0) Check table: Conversion Routine: Domain Name: CHAR17 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPDMR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBPBAP-SALESDOCUMENTITEM table field - Sales Document Order
▼
Description: Sales Document Order Field Name: SALESDOCUMENTITEM Data Element: /CPD/PWS_RCB_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPBAP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPRRB-SALESDOCUMENTITEM table field - Sales Document Order
▼
Description: Sales Document Order Field Name: SALESDOCUMENTITEM Data Element: /CPD/PWS_RCB_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPRRB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCDFA-SALESDOCUMENTITEM table field - Preceding Item of an SD Document
▼
Description: Preceding Item of an SD Document Field Name: SALESDOCUMENTITEM Data Element: POSNR_VON Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCDFA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCICG-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCICG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCLRSO-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCLRSO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMPWBS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPWBS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBPDATA-SALESDOCUMENTITEM table field - Sales Document Order
▼
Description: Sales Document Order Field Name: SALESDOCUMENTITEM Data Element: /CPD/PWS_RCB_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPCLRSO-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPCLRSO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCDFWS-SALESDOCUMENTITEM table field - Preceding Item of an SD Document
▼
Description: Preceding Item of an SD Document Field Name: SALESDOCUMENTITEM Data Element: POSNR_VON Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCDFWS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCICOP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCICOP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDIWPA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDIWPA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISLSCIC-SALESDOCUMENTITEM table field - Higher-Level Item in Bill of Material Structures
▼
Description: Higher-Level Item in Bill of Material Structures Field Name: SALESDOCUMENTITEM Data Element: UEPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSCIC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMPHIER-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPHIER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CWUPCSOI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWUPCSOI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPDMREQ-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPDMREQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRACCWD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDIWPAA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDIWPAA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PGRCSODD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PGRCSODD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMPBPBAP-SALESDOCUMENTITEM table field - Sales Document Order
▼
Description: Sales Document Order Field Name: SALESDOCUMENTITEM Data Element: /CPD/PWS_RCB_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPBPBAP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMPBPFIX-SALESDOCUMENTITEM table field - Sales Document Order
▼
Description: Sales Document Order Field Name: SALESDOCUMENTITEM Data Element: /CPD/PWS_RCB_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPBPFIX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMPBPRRB-SALESDOCUMENTITEM table field - Sales Document Order
▼
Description: Sales Document Order Field Name: SALESDOCUMENTITEM Data Element: /CPD/PWS_RCB_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPBPRRB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMPWSBDD-SALESDOCUMENTITEM table field - Sales Document Order
▼
Description: Sales Document Order Field Name: SALESDOCUMENTITEM Data Element: /CPD/PWS_RCB_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPWSBDD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PWUPCSOI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PWUPCSOI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CGRCNPSOR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCNPSOR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURREQQV-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQQV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBPFPSTAT-SALESDOCUMENTITEM table field - Sales Document Order
▼
Description: Sales Document Order Field Name: SALESDOCUMENTITEM Data Element: /CPD/PWS_RCB_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPFPSTAT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBPSDDATA-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPSDDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPBPCUBE-SALESDOCUMENTITEM table field - Sales Document Order
▼
Description: Sales Document Order Field Name: SALESDOCUMENTITEM Data Element: /CPD/PWS_RCB_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPBPCUBE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPCREDIT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPCREDIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURREQQV-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQQV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRFMSDITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMSDITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCICWUOM-SALESDOCUMENTITEM table field - Higher-Level Item in Bill of Material Structures
▼
Description: Higher-Level Item in Bill of Material Structures Field Name: SALESDOCUMENTITEM Data Element: UEPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCICWUOM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PABOPSDSL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PABOPSDSL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMPSTRELM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPSTRELM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSIMOBJSR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIMOBJSR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
APURREQACC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURREQACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCRVMLSLSQ-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCRVMLSLSQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMPAGEDEBT-SALESDOCUMENTITEM table field - Commercial Project Sales Order Item
▼
Description: Commercial Project Sales Order Item Field Name: SALESDOCUMENTITEM Data Element: /CPD/CPM_SOITEM Data Type: CHAR length (Dec): 17(0) Check table: Conversion Routine: Domain Name: CHAR17 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPAGEDEBT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMPINVOICE-SALESDOCUMENTITEM table field - Commercial Project Sales Order Item
▼
Description: Commercial Project Sales Order Item Field Name: SALESDOCUMENTITEM Data Element: /CPD/CPM_SOITEM Data Type: CHAR length (Dec): 17(0) Check table: Conversion Routine: Domain Name: CHAR17 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPINVOICE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
COPLADICOR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COPLADICOR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBPALLDATA-SALESDOCUMENTITEM table field - Sales Document Order
▼
Description: Sales Document Order Field Name: SALESDOCUMENTITEM Data Element: /CPD/PWS_RCB_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPALLDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBPBAPSTAT-SALESDOCUMENTITEM table field - Sales Document Order
▼
Description: Sales Document Order Field Name: SALESDOCUMENTITEM Data Element: /CPD/PWS_RCB_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPBAPSTAT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBPCPMDATA-SALESDOCUMENTITEM table field - Sales Document Order
▼
Description: Sales Document Order Field Name: SALESDOCUMENTITEM Data Element: /CPD/PWS_RCB_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPCPMDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBPRRBSTAT-SALESDOCUMENTITEM table field - Sales Document Order
▼
Description: Sales Document Order Field Name: SALESDOCUMENTITEM Data Element: /CPD/PWS_RCB_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPRRBSTAT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICRVMLSLSC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICRVMLSLSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICRVMLSLSF-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICRVMLSLSF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICUSTORDER-SALESDOCUMENTITEM table field - MRP element item
▼
Description: MRP element item Field Name: SALESDOCUMENTITEM Data Element: PPH_DELPS Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: PPH_DELPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICUSTORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPDMRCUBE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPDMRCUBE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPINVCUBE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPINVCUBE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPINVOICE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPINVOICE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPSUMMARY-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPSUMMARY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDITEMORG-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDITEMORG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PBPCPMDATA-SALESDOCUMENTITEM table field - Sales Document Order
▼
Description: Sales Document Order Field Name: SALESDOCUMENTITEM Data Element: /CPD/PWS_RCB_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PBPCPMDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRFNDEDQTY-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRFNDEDQTY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDOSDDATE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDOSDDATE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSIMOBJUNI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIMOBJUNI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CJRNLENICOR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CJRNLENICOR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMPAGEDEBTC-SALESDOCUMENTITEM table field -
▼
Description: Field Name: SALESDOCUMENTITEM Data Element: Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPAGEDEBTC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMPBILLPLAN-SALESDOCUMENTITEM table field -
▼
Description: Field Name: SALESDOCUMENTITEM Data Element: Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPBILLPLAN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPLSAFTDPCI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPLSAFTDPCI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSIMOBJSRCH-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSIMOBJSRCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IACELINEITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACELINEITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IARUNSOITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IARUNSOITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBPMASTPROJ-SALESDOCUMENTITEM table field - Sales Document Order
▼
Description: Sales Document Order Field Name: SALESDOCUMENTITEM Data Element: /CPD/PWS_RCB_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPMASTPROJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFINOCRTSOI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFINOCRTSOI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPHIERLIST-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPHIERLIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPSALESODR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPSALESODR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PACELINEITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACELINEITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PEPSALESORD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEPSALESORD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMPHIRSALES-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPHIRSALES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMPSOPURDOC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPSOPURDOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMPSOSUBDOC-SALESDOCUMENTITEM table field - Subsequent Item of an SD Document
▼
Description: Subsequent Item of an SD Document Field Name: SALESDOCUMENTITEM Data Element: POSNR_NACH Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPSOSUBDOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
POCRROOTSOI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POCRROOTSOI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
POCRSOI2PRD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POCRSOI2PRD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
POCRSOI2WBS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POCRSOI2WBS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRETSREFDOC-SALESDOCUMENTITEM table field - Item number of the reference item
▼
Description: Item number of the reference item Field Name: SALESDOCUMENTITEM Data Element: VGPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRETSREFDOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSIMSCHSUPP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIMSCHSUPP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSOFTREED20-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSOFTREED20 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RFMSCCSDORD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RFMSCCSDORD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RFMSCCSOSCH-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RFMSCCSOSCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCPSOIATTRIB-SALESDOCUMENTITEM table field - Sales Order Item
▼
Description: Sales Order Item Field Name: SALESDOCUMENTITEM Data Element: SALES_ORDER_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCPSOIATTRIB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CEXRQMTSDITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEXRQMTSDITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIGLITMCMPQ-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIGLITMCMPQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIPROFQ0002-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIPROFQ0002 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDMCCCHGKEY-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCCCHGKEY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSLSDOCITMDP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSDOCITMDP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IEXRQMTSDITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEXRQMTSDITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMRPPURCHREQ-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPPURCHREQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPLSAFTDPSOI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPLSAFTDPSOI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDDOCITEMRO-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDDOCITEMRO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDMCCCHGKEY-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDMCCCHGKEY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PHIERLISTSKF-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PHIERLISTSKF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMPEMATLTOCK-SALESDOCUMENTITEM table field - Sales Order Item of Valuated Sales Order Stock
▼
Description: Sales Order Item of Valuated Sales Order Stock Field Name: SALESDOCUMENTITEM Data Element: MAT_KDPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: NUM06 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPEMATLTOCK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PREQUANF1708-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PREQUANF1708 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRUEXCHDIFF0-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRUEXCHDIFF0 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSALESDOCITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSALESDOCITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDOSDITMAGG-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDOSDITMAGG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDSLSANALYT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSANALYT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SDMCC_CHGKEY-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDMCC_CHGKEY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SDMCC_JOBLOG-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDMCC_JOBLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CEBRRSDDOCRSL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEBRRSDDOCRSL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CEXRQMTACCITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEXRQMTACCITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIJELITBROWS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIJELITBROWS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMPBILLRCVSUM-SALESDOCUMENTITEM table field -
▼
Description: Field Name: SALESDOCUMENTITEM Data Element: Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPBILLRCVSUM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CODRWOCMF1708-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CODRWOCMF1708 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRACCTASSGMT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRACCTASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPROSRVMARGIN-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPROSRVMARGIN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRRBDYNITMFLW-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRRBDYNITMFLW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDMCCITMSRCH-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCCITMSRCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESDDOCPARTNER-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESDDOCPARTNER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FACZ3SDHDRITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FACZ3SDHDRITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IEXRQMTACCITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEXRQMTACCITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IEXRQMTSDMITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEXRQMTSDMITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPEMATLSTOCK-SALESDOCUMENTITEM table field - Sales Order Item of Valuated Sales Order Stock
▼
Description: Sales Order Item of Valuated Sales Order Stock Field Name: SALESDOCUMENTITEM Data Element: MAT_KDPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: NUM06 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPEMATLSTOCK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRETQTYUF1708-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRETQTYUF1708 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRRBDYNITMFLW-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRRBDYNITMFLW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDDOCCMPLTRO-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDDOCCMPLTRO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDMCCMCHGDOC-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDMCCMCHGDOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDSLSANACUBE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSANACUBE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDSLSDOCITPT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSDOCITPT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDSLSDOCITRO-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSDOCITRO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISLSDOCITEMBP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSDOCITEMBP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISLSORDGNRCAG-SALESDOCUMENTITEM table field - Higher-Level Item in Bill of Material Structures
▼
Description: Higher-Level Item in Bill of Material Structures Field Name: SALESDOCUMENTITEM Data Element: UEPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSORDGNRCAG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISOITMRETDQTY-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISOITMRETDQTY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUPDMNDOVWSD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPDMNDOVWSD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUPPLYASSGMT-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: ARUN_SDITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPPLYASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NPRACCTASSGMT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NPRACCTASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PARLINEITEM10-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARLINEITEM10 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPLSAFTDPSDPI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPLSAFTDPSDPI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPRCFIXOPTSLS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRCFIXOPTSLS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRRBDYNITMFLW-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRRBDYNITMFLW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDISSACCRREV-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDISSACCRREV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDSLSORDCONF-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSORDCONF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSLSDOCITMBSC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSDOCITMBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
V_MRP_PUR_REQ-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_CO Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_MRP_PUR_REQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CEXRQMTCONTITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEXRQMTCONTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CINQYITRLTDOCS-SALESDOCUMENTITEM table field - Subsequent Item of an SD Document
▼
Description: Subsequent Item of an SD Document Field Name: SALESDOCUMENTITEM Data Element: POSNR_NACH Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINQYITRLTDOCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CINVTRGLACBALC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINVTRGLACBALC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CINVTRGLACBALQ-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINVTRGLACBALQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMANPRODNORDER-SALESDOCUMENTITEM table field - Sales Order Item
▼
Description: Sales Order Item Field Name: SALESDOCUMENTITEM Data Element: CO_KDPOS Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMANPRODNORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRJBLGELMETRF-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRJBLGELMETRF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRFMMASADOGADV-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMMASADOGADV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDSLSDOCITMDX-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSLSDOCITMDX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSLSOITMATTRIB-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSOITMATTRIB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSOFSLSDOCITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: SALES_DOC_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSOFSLSDOCITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSOWOCHARGEITM-SALESDOCUMENTITEM table field - Sales Order Without Charge Item
▼
Description: Sales Order Without Charge Item Field Name: SALESDOCUMENTITEM Data Element: SALES_ORDER_WITHOUT_CHARGE_ITM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSOWOCHARGEITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSSPPRMAINTACC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSSPPRMAINTACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IALIGNSOHDRITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IALIGNSOHDRITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IANALACCRPOSTG-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IANALACCRPOSTG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IEXRQMTCONTITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEXRQMTCONTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IHIERARCHYLIST-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IHIERARCHYLIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IITMPCOMPF1708-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IITMPCOMPF1708 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPBILLSUMMARY-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPBILLSUMMARY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPEBATCHSTOCK-SALESDOCUMENTITEM table field - Sales Order Item
▼
Description: Sales Order Item Field Name: SALESDOCUMENTITEM Data Element: CO_KDPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPEBATCHSTOCK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPSTRUCTELEMT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPSTRUCTELEMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMRPPURCHORDER-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_CO Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPPURCHORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRETQTYOSF1708-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRETQTYOSF1708 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRRBMASSRELJOB-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRRBMASSRELJOB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDMCCMCHGLOGB-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDMCCMCHGLOGB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDMCCMCHGRQSL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDMCCMCHGRQSL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDSLSANACUBE1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSANACUBE1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISLSDOCITMNSPT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSDOCITMNSPT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISLSDOCITMRSEG-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSDOCITMRSEG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUPDMNDOVWITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPDMNDOVWITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PANALACCRPOSTG-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PANALACCRPOSTG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCNJRNLENTRITM-SALESDOCUMENTITEM table field -
▼
Description: Field Name: SALESDOCUMENTITEM Data Element: Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCNJRNLENTRITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PDELIVPROCGDLY-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDELIVPROCGDLY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PDELIVPROCGPAD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDELIVPROCGPAD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PDELIVPROCGPTD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDELIVPROCGPTD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PEBRRSDDOCJOUR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBRRSDDOCJOUR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMPEBATCHSTOCK-SALESDOCUMENTITEM table field - Sales Order Item of Valuated Sales Order Stock
▼
Description: Sales Order Item of Valuated Sales Order Stock Field Name: SALESDOCUMENTITEM Data Element: MAT_KDPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: NUM06 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPEBATCHSTOCK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMPOPENINVOICE-SALESDOCUMENTITEM table field - Subsequent Item of an SD Document
▼
Description: Subsequent Item of an SD Document Field Name: SALESDOCUMENTITEM Data Element: POSNR_NACH Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPOPENINVOICE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPRCFIXEXERSLS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRCFIXEXERSLS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRRBDYNITMFLW2-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRRBDYNITMFLW2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSLSDOCITEMPAD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSDOCITEMPAD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSLSDOCITEMPTD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSDOCITEMPTD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSLSORDPROCF12-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSORDPROCF12 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSOFISSUESO021-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSOFISSUESO021 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSOFISSUESU011-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSOFISSUESU011 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSOFISSUESU013-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSOFISSUESU013 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSOFISSUESU014-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSOFISSUESU014 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFITRIALBALANCE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFITRIALBALANCE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CODRWOCHRGF1708-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CODRWOCHRGF1708 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRDTDELIVDELAY-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: SALES_DOC_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRDTDELIVDELAY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRFMMASADOITMDV-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMMASADOITMDV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDCUSTRETRATEQ-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDCUSTRETRATEQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDDPLSLSDOCITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDDPLSLSDOCITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDSLSDOCITMDX1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSLSDOCITMDX1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSLSDOCBYOBJSTS-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSDOCBYOBJSTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSLSDOCITEMSO01-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: SALES_DOC_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSDOCITEMSO01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSLSDOCITEMSO02-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: SALES_DOC_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSDOCITEMSO02 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSLSDOCITEMSO04-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: SALES_DOC_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSDOCITEMSO04 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSLSDOCITEMSO05-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: SALES_DOC_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSDOCITEMSO05 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSLSDOCITEMSO06-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: SALES_DOC_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSDOCITEMSO06 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSLSDOCITEMSO07-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: SALES_DOC_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSDOCITEMSO07 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSLSDOCITEMSO08-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: SALES_DOC_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSDOCITEMSO08 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESDSLSDOCITMBSC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESDSLSDOCITMBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINOC_MOCKRTSOI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINOC_MOCKRTSOI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IALIGNSLSAASCHE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IALIGNSLSAASCHE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IEXRQMTSDMSOITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEXRQMTSDMSOITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIFINPLNENTITC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIFINPLNENTITC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRETAQTYOSF1708-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRETAQTYOSF1708 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISAFTDELITEMTCS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISAFTDELITEMTCS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDCUSTRETRATEA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCUSTRETRATEA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDCUSTRETRATEC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCUSTRETRATEC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDMCCMCHGRQLOG-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDMCCMCHGRQLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDSALESDOCITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSALESDOCITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDSLSDOCEXTITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSDOCEXTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDSLSDOCITMBSC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSDOCITMBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDSLSSDOCITMVH-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSSDOCITMVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISLSDOCITENHFLD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSDOCITENHFLD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISOITEMRETBLQTY-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISOITEMRETBLQTY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ITMDELIVCRTNDTE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITMDELIVCRTNDTE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IVARCONFSLSNTVB-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVARCONFSLSNTVB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PALSLSORDSCHEDL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PALSLSORDSCHEDL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PALSLSORDSTATUS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PALSLSORDSTATUS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PDELIVPROCGPTD1-SALESDOCUMENTITEM table field - Item number of the reference item
▼
Description: Item number of the reference item Field Name: SALESDOCUMENTITEM Data Element: VGPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDELIVPROCGPTD1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PDMVCSDDOCITMVH-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDMVCSDDOCITMVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PEVTBSDRRECEVAL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEVTBSDRRECEVAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PEXPDORDNAMTITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEXPDORDNAMTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PLESOIFLFMTANLY-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLESOIFLFMTANLY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPLSAFTDWPAYITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPLSAFTDWPAYITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPRCFIXOPTBHSLS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRCFIXOPTBHSLS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPRCFIXOPTCNSLS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRCFIXOPTCNSLS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRRBDYNITMFLW00-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRRBDYNITMFLW00 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDISSACCRCOSTS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDISSACCRCOSTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDISSUNBILLREV-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDISSUNBILLREV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDOCITEMUIPROP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDOCITEMUIPROP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSLSDOCBYOBJSTS-SALESDOCUMENTITEM table field -
▼
Description: Field Name: SALESDOCUMENTITEM Data Element: Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSDOCBYOBJSTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSLSDOCITEMPTD1-SALESDOCUMENTITEM table field - Item number of the reference item
▼
Description: Item number of the reference item Field Name: SALESDOCUMENTITEM Data Element: VGPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSDOCITEMPTD1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSLSDOCITEMSO21-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSDOCITEMSO21 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSLSDOCITMINHPT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSDOCITMINHPT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSODUEDATEREU22-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSODUEDATEREU22 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSODUEDATEREU24-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSODUEDATEREU24 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSODUEDATEREUS2-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSODUEDATEREUS2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSODUEDATEREUS4-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSODUEDATEREUS4 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSOFSLSDOCITEM1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSOFSLSDOCITEM1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PVARCONFSLSNTVB-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PVARCONFSLSNTVB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
V_MRP_PURCH_DOC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_CO Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_MRP_PURCH_DOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CESJIBILGDOCITMQ-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CESJIBILGDOCITMQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CEXCHSCIQTYSCHED-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEXCHSCIQTYSCHED table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CEXGSLSISCHEDKPI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEXGSLSISCHEDKPI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIMARKSEGMQ2501-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIMARKSEGMQ2501 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIMSPLANACT2501-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIMSPLANACT2501 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRFMASADOITDVCHK-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMASADOITDVCHK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRFMMASADOGNRCDV-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMMASADOGNRCDV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRFMMASADOITMBSC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMMASADOITMBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRFMMASADOITMDEV-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMMASADOITMDEV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRRBSLSPRDYNITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRRBSLSPRDYNITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRRBWRTOFFDYNITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRRBWRTOFFDYNITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRTNRDOCITMF1708-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRTNRDOCITMF1708 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDOCWCUSTEXPPRC-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDOCWCUSTEXPPRC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDSDOCSCHDLNDX1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSDOCSCHDLNDX1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDSDOCSCHEDLNDX-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSDOCSCHEDLNDX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDSLSANALYTICQ1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSLSANALYTICQ1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDSLSANALYTICSQ-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSLSANALYTICSQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSLSDOCITMSRCHLP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSDOCITMSRCHLP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSLSDOCSCHDLSO02-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSDOCSCHDLSO02 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSOFSLSDOCITEMPR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: SALES_DOC_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSOFSLSDOCITEMPR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSOFSLSDOCSCHDLN-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSOFSLSDOCSCHDLN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSOWOCHRGRPLMATL-SALESDOCUMENTITEM table field - Sales Order Without Charge Item
▼
Description: Sales Order Without Charge Item Field Name: SALESDOCUMENTITEM Data Element: SALES_ORDER_WITHOUT_CHARGE_ITM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSOWOCHRGRPLMATL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINOCV_RTSOIFILL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINOCV_RTSOIFILL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINOCV_RTSOIMNTH-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINOCV_RTSOIMNTH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IALIGNAASLSITMSL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IALIGNAASLSITMSL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IEVTBSDRROBJLICY-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEVTBSDRROBJLICY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IEXCHSCIQTYSCHED-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEXCHSCIQTYSCHED table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IEXRQMTAGGSLSITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEXRQMTAGGSLSITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IEXRQMTSDMSOITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEXRQMTSDMSOITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IITMCONFDELIVDTE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IITMCONFDELIVDTE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IITMREQDDELIVDTE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IITMREQDDELIVDTE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMASADOAGGSLSITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMASADOAGGSLSITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPCUSTCLEARITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPCUSTCLEARITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPLSAFTSALESORDI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPLSAFTSALESORDI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDBLNPLNDDTEANA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBLNPLNDDTEANA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDDOCITMRETNQTY-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDDOCITMRETNQTY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDMCCMCHGREQERR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDMCCMCHGREQERR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDSCHEDLINENANA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSCHEDLINENANA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDSLSCONTITMANA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSCONTITMANA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDSLSDOCIFLFMTA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSDOCIFLFMTA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDSLSDOCITMANTS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSDOCITMANTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDSLSDOCITMFLFM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSDOCITMFLFM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDSLSDOCITMPREL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSDOCITMPREL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDSLSDOCSCHEDLN-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSDOCSCHEDLN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDSLSQTANITMANA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSQTANITMANA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISLSDOCITMCMPLPT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSDOCITMCMPLPT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUPDMNDOVWSDITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPDMNDOVWSDITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PAVCSALESDOCITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAVCSALESDOCITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PEVTBSDRROBJLICY-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEVTBSDRROBJLICY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPPFCSTDMNDSALES-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPPFCSTDMNDSALES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPPRJBLGELMFLW00-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPPRJBLGELMFLW00 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPRDTDELIVDELAY1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRDTDELIVDELAY1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPRDTDELVCRTNDLY-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRDTDELVCRTNDLY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRRBSLSPRDYNITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRRBSLSPRDYNITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRRBWRTOFFDYNITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRRBWRTOFFDYNITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDBILLGPLNDUDTA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDBILLGPLNDUDTA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDCNTDITMNSTDPT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDCNTDITMNSTDPT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDDOCISSDEFERRE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDDOCISSDEFERRE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDISSDEFERCOSTS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDISSDEFERCOSTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDOPNSLSORDFBPA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDOPNSLSORDFBPA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDOPNSLSORDINVA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDOPNSLSORDINVA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDOPNSLSORDSFDA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDOPNSLSORDSFDA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDSLSDOCIFLFMTA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSDOCIFLFMTA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDSLSDOCITMALYS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSDOCITMALYS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDSLSDOCITMFLF0-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSDOCITMFLF0 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDSLSDOCITMFLF1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSDOCITMFLF1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDSLSDOCITMFLF2-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSDOCITMFLF2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDSLSDOCITMFLF3-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSDOCITMFLF3 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDSLSDOCITMFLF4-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSDOCITMFLF4 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDSLSDOCSCHEDLA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSDOCSCHEDLA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDSLSDOCSCHLAYS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSDOCSCHLAYS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSLSDOCITMNSPTCT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSDOCITMNSPTCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSLSORDITEMSO021-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSORDITEMSO021 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSODUEDATEREUS27-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSODUEDATEREUS27 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSODUEDATEREUS29-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSODUEDATEREUS29 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSODUEDATEREUSE7-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSODUEDATEREUSE7 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSODUEDATEREUSE9-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSODUEDATEREUSE9 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSOFTOTALAMOUNT1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSOFTOTALAMOUNT1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSUPDMNDOVWSDDT2-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSUPDMNDOVWSDDT2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VCH_SIM_SCH_SUPP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VCH_SIM_SCH_SUPP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRFLT-SALESDOCUMENTITEM table field - Item Number of a Logistics Document
▼
Description: Item Number of a Logistics Document Field Name: SALESDOCUMENTITEM Data Element: EHFND_LOG_DOC_VBELN_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: EHFND_LOG_DOC_VBELN_POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRFLT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICRQTP-SALESDOCUMENTITEM table field - Item Number of a Logistics Document
▼
Description: Item Number of a Logistics Document Field Name: SALESDOCUMENTITEM Data Element: EHFND_LOG_DOC_VBELN_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: EHFND_LOG_DOC_VBELN_POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICRQTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UPRFLT-SALESDOCUMENTITEM table field - Item Number of a Logistics Document
▼
Description: Item Number of a Logistics Document Field Name: SALESDOCUMENTITEM Data Element: EHFND_LOG_DOC_VBELN_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: EHFND_LOG_DOC_VBELN_POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UPRFLT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSKFVAL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSKFVAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRAMPD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRAMPD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISKFVTP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISKFVTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PADBKFC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PADBKFC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PACESPST-SALESDOCUMENTITEM table field - Item number in Sales Order
▼
Description: Item number in Sales Order Field Name: SALESDOCUMENTITEM Data Element: KDPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: NUM06 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACESPST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RFIONRVB-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RFIONRVB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SDRO-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SDRO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ASDBDITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASDBDITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CEBRRRVSL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEBRRRVSL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSKFVALIT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSKFVALIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPKANBAN-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: VDM_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPKANBAN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISKFVITTP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISKFVITTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PEBRRRVSL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBRRRVSL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSLSITMCD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSITMCD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RFIAPITEM-SALESDOCUMENTITEM table field - Item Number (6 Digits)
▼
Description: Item Number (6 Digits) Field Name: SALESDOCUMENTITEM Data Element: FARP_POSN2 Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RFIAPITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RFIARITEM-SALESDOCUMENTITEM table field - Item Number (6 Digits)
▼
Description: Item Number (6 Digits) Field Name: SALESDOCUMENTITEM Data Element: FARP_POSN2 Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RFIARITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMPESFOGEN-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: VDM_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPESFOGEN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSTCKISSUE-SALESDOCUMENTITEM table field - MRP element item
▼
Description: MRP element item Field Name: SALESDOCUMENTITEM Data Element: PPH_DELPS Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: PPH_DELPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSTCKISSUE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHFNDV_CRQ-SALESDOCUMENTITEM table field - Item Number of a Logistics Document
▼
Description: Item Number of a Logistics Document Field Name: SALESDOCUMENTITEM Data Element: EHFND_LOG_DOC_VBELN_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: EHFND_LOG_DOC_VBELN_POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHFNDV_CRQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FSUBVALJEI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FSUBVALJEI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IADBKFCUBE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IADBKFCUBE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFICO__VH1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFICO__VH1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFPRLITEMS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFPRLITEMS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIRECITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIRECITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PJPARDOCIT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PJPARDOCIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRACCTWI_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRACCTWI_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSLSITMSIT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSITMSIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PWUSKFATAO-SALESDOCUMENTITEM table field -
▼
Description: Field Name: SALESDOCUMENTITEM Data Element: Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PWUSKFATAO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SKFV_DRAFT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SKFV_DRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRDPROFBIQ-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRDPROFBIQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDDOCISSUE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDDOCISSUE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IALIGNMTDET-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IALIGNMTDET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICCMPLCNREQ-SALESDOCUMENTITEM table field - Item Number of a Logistics Document
▼
Description: Item Number of a Logistics Document Field Name: SALESDOCUMENTITEM Data Element: EHFND_LOG_DOC_VBELN_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: EHFND_LOG_DOC_VBELN_POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCMPLCNREQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFICOOBJECT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFICOOBJECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPDACCASSIN-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_CO Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPDACCASSIN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPMFGORDER-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: VDM_POSNR Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMFGORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROFITABIC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROFITABIC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRFMSITMSIT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMSITMSIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISAFTLITMCA-SALESDOCUMENTITEM table field - Item number in Sales Order
▼
Description: Item number in Sales Order Field Name: SALESDOCUMENTITEM Data Element: KDPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: NUM06 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISAFTLITMCA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSUEDETAIL-SALESDOCUMENTITEM table field - MRP element item
▼
Description: MRP element item Field Name: SALESDOCUMENTITEM Data Element: PPH_DELPS Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: PPH_DELPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUEDETAIL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PACTLSFOREP-SALESDOCUMENTITEM table field - Sales Order Item
▼
Description: Sales Order Item Field Name: SALESDOCUMENTITEM Data Element: SALES_ORDER_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACTLSFOREP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PADBKFCITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PADBKFCITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PDMVCMANODE-SALESDOCUMENTITEM table field -
▼
Description: Field Name: SALESDOCUMENTITEM Data Element: Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDMVCMANODE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PEBRRSORSLT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBRRSORSLT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIRECITEM1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIRECITEM1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
POCRPOI2SOI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POCRPOI2SOI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
AFIGLACCTLIT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AFIGLACCTLIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CALLOCRUNJEI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CALLOCRUNJEI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CALLOCRUNRES-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CALLOCRUNRES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCNFPRLITEMS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNFPRLITEMS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNOSAFTJITMC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNOSAFTJITMC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNOSAFTJITMQ-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNOSAFTJITMQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDSALESVLMQ-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSALESVLMQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDSLSCDITEM-SALESDOCUMENTITEM table field -
▼
Description: Field Name: SALESDOCUMENTITEM Data Element: Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSLSCDITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSKFVALACTIT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSKFVALACTIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DRAFT_PR_ACC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DRAFT_PR_ACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EDOC_LE_BSEG-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EDOC_LE_BSEG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EDOC_LE_VBRP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EDOC_LE_VBRP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IALLOCRUNRES-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IALLOCRUNRES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIACTPLNJEI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIACTPLNJEI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIGLACCTBAL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLACCTBAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIGLACCTLIR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLACCTLIR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIGLACCTLIT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLACCTLIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIGLBALANCE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLBALANCE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIGLBALCUBE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLBALCUBE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IGLSUBLDGITP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGLSUBLDGITP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRACCTASSGB-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCTASSGB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPTSAFTLITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPTSAFTLITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURREQNACCT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNACCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISAFTCOMPDOC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISAFTCOMPDOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PALLOCRUNRES-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PALLOCRUNRES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PAPLINEITEM0-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAPLINEITEM0 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PAPLINEITEM1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAPLINEITEM1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PAPLINEITEM2-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAPLINEITEM2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PAPLINEITEM3-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAPLINEITEM3 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PAPLINEITEM4-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAPLINEITEM4 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PAPLINEITEM6-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAPLINEITEM6 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PARLINEITEM0-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARLINEITEM0 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PARLINEITEM1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARLINEITEM1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PARLINEITEM2-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARLINEITEM2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PARLINEITEM3-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARLINEITEM3 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PARLINEITEM4-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARLINEITEM4 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PARLINEITEM7-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARLINEITEM7 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PARLINEITEM9-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARLINEITEM9 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PDMVCMATLVAL-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDMVCMATLVAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIACTPLNJEI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIACTPLNJEI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIGLBALCOMP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGLBALCOMP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIPLANLITST-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIPLANLITST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRHIACCTWI_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRHIACCTWI_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSEMTAGSLITP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSEMTAGSLITP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSKFVALACTIT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSKFVALACTIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SDRO_KEY-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SDRO_KEY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ARUNVASSDASSG-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARUNVASSDASSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ARUNVASSDITMS-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARUNVASSDITMS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ARUNVASSDSRVC-SALESDOCUMENTITEM table field - Item number of the reference item
▼
Description: Item number of the reference item Field Name: SALESDOCUMENTITEM Data Element: VGPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARUNVASSDSRVC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDSPMATVALCHN-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDSPMATVALCHN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIGLACCTFLOW-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIGLACCTFLOW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CGBPRMAINTACC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGBPRMAINTACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FACZ3BLHDRITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FACZ3BLHDRITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_DZAPLNITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZAPLNITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_DZAPOPITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZAPOPITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_DZARLNITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZARLNITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_DZAROPITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZAROPITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IEXRQMTAGGQTY-SALESDOCUMENTITEM table field - Preceding Item of an SD Document
▼
Description: Preceding Item of an SD Document Field Name: SALESDOCUMENTITEM Data Element: POSNR_VON Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEXRQMTAGGQTY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIACTPLNJEIC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIACTPLNJEIC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIAPLINEITEM-SALESDOCUMENTITEM table field - Item Number (6 Digits)
▼
Description: Item Number (6 Digits) Field Name: SALESDOCUMENTITEM Data Element: FARP_POSN2 Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIAPLINEITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIARLINEITEM-SALESDOCUMENTITEM table field - Item Number (6 Digits)
▼
Description: Item Number (6 Digits) Field Name: SALESDOCUMENTITEM Data Element: FARP_POSN2 Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIARLINEITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFICOOBJECTEN-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFICOOBJECTEN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIGLICMPCUBE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLICMPCUBE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIGLLITMCUBE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLLITMCUBE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIJELITBROWS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIJELITBROWS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIJRNLENTOPV-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIJRNLENTOPV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIPROFANADOC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIPROFANADOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIRECPAYITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIRECPAYITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPKANBANCONT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: VDM_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPKANBANCONT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRACCTASSGMT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCTASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRACCTWRKITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCTWRKITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROSRVMARGIN-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROSRVMARGIN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPSMS4BDLNBSC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSMS4BDLNBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPTJRNLENTRYI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPTJRNLENTRYI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRFMMASADOITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMASADOITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRFMPRVSNLITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMPRVSNLITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISAFTBILLITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISAFTBILLITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISA_SPLTORDER-SALESDOCUMENTITEM table field - Sales Order Item
▼
Description: Sales Order Item Field Name: SALESDOCUMENTITEM Data Element: CO_KDPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISA_SPLTORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PALLOCRUNJEI1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PALLOCRUNJEI1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PALLOCRUNJEI2-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PALLOCRUNJEI2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PDMVCMATERIAL-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDMVCMATERIAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PDMVCNODEATTR-SALESDOCUMENTITEM table field -
▼
Description: Field Name: SALESDOCUMENTITEM Data Element: Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDMVCNODEATTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PDMVCNODEDATA-SALESDOCUMENTITEM table field - Sales Document Item in Character
▼
Description: Sales Document Item in Character Field Name: SALESDOCUMENTITEM Data Element: POSNR_CHAR Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR_CHAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDMVCNODEDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PDRCRRBPAYITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDRCRRBPAYITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFICOOBJECTEN-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFICOOBJECTEN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIGLBALCOMP1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGLBALCOMP1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIJELITBROWS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIJELITBROWS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIPLNLITSTGL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIPLNLITSTGL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDDOCISSJOUR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDDOCISSJOUR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSIMFORSEARCH-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIMFORSEARCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PURREQNACCT_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURREQNACCT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
API_KANBANCONT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: VDM_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP API_KANBANCONT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ARUNVASSDDATE1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARUNVASSDDATE1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ARUNVASSDDATE2-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARUNVASSDDATE2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ASLSPRCGCNDNVA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASLSPRCGCNDNVA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CANALACCRPOSTG-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CANALACCRPOSTG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBDOCITEMF0797-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBDOCITEMF0797 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCHGIMPPUOITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_CO Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGIMPPUOITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCOGSSPLRELGLI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOGSSPLRELGLI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CEBRRSDDOCRSLT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEBRRSDDOCRSLT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFISTKEYFIGITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFISTKEYFIGITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMPOMFGORDCUST-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: VDM_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPOMFGORDCUST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRACCTASSMTWI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRACCTASSMTWI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRELCRETDELFFS-SALESDOCUMENTITEM table field - Subsequent Item of an SD Document
▼
Description: Subsequent Item of an SD Document Field Name: SALESDOCUMENTITEM Data Element: POSNR_NACH Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRELCRETDELFFS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRELSOITDELFFS-SALESDOCUMENTITEM table field - Subsequent Item of an SD Document
▼
Description: Subsequent Item of an SD Document Field Name: SALESDOCUMENTITEM Data Element: POSNR_NACH Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRELSOITDELFFS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRETSREFDOCITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRETSREFDOCITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDMCSLSDOCREQ-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCSLSDOCREQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDSDOCITMPEDX-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSDOCITMPEDX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EBKN_SSP_ACC_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBKN_SSP_ACC_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_DZAPLNITMB-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZAPLNITMB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_DZAPTRIBAL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZAPTRIBAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_DZARLNITMB-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZARLNITMB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_DZARTRIBAL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZARTRIBAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_DZGLTRIBAL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZGLTRIBAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICHGIMPPUOACCT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_CO Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICHGIMPPUOACCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICOSREVREASSTP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICOSREVREASSTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIDOCJRNLCUBE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIDOCJRNLCUBE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIFINPLNENTIT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIFINPLNENTIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIGLACCTLITST-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLACCTLITST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIPLANLITSTGL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIPLANLITSTGL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFISTKEYFIGITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFISTKEYFIGITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPEMANORDERTP-SALESDOCUMENTITEM table field - Sales Order Item
▼
Description: Sales Order Item Field Name: SALESDOCUMENTITEM Data Element: CO_KDPOS Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPEMANORDERTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPSMS4CBDLNANC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSMS4CBDLNANC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPTSAFTDELTAXS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPTSAFTDELTAXS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURREQNACCTWD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNACCTWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRFMMASADODITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMASADODITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDBILDOCEXITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILDOCEXITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDBILDOCREQIT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILDOCREQIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDBILLDOCITBC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILLDOCITBC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISLSPRCGCNDNVA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSPRCGCNDNVA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMANAGEORDERS-SALESDOCUMENTITEM table field - Sales Order Item
▼
Description: Sales Order Item Field Name: SALESDOCUMENTITEM Data Element: CO_KDPOS Data Type: NUMC length (Dec): 6(0) Check table: * Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMANAGEORDERS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_EXT_EBKN-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_EXT_EBKN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PEPGLACCTRDATA-SALESDOCUMENTITEM table field - Sales Order Item
▼
Description: Sales Order Item Field Name: SALESDOCUMENTITEM Data Element: SALES_ORDER_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEPGLACCTRDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PEWMWHSETASK01-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEWMWHSETASK01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIGLACCTCDBAL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGLACCTCDBAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIGLACCTLITST-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGLACCTLITST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIPLANLITSTFA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIPLANLITSTFA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIPLANLITSTGL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIPLANLITSTGL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIPLANLITSTUN-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIPLANLITSTUN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFISTKEYFIGITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFISTKEYFIGITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDBILLFORPROJ-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDBILLFORPROJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSETTLMTACTVAL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSETTLMTACTVAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSLSPRCGCNDNVA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSPRCGCNDNVA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SDPRCG_CNDNR_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDPRCG_CNDNR_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SKFVITEM_DRAFT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SKFVITEM_DRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_BD_SO_ITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_BD_SO_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ARUNVASBDBSASST-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: ARUN_SDITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARUNVASBDBSASST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ARUNVASSDITMBSC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARUNVASSDITMBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ARUNVASSDMNDDOC-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARUNVASSDMNDDOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ARUNVASSDRQTITM-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARUNVASSDRQTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CALLOCRUNRESITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CALLOCRUNRESITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCOSREVREASSGMT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOSREVREASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCOSREVREASSITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOSREVREASSITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIN_AVCI_ITEME-SALESDOCUMENTITEM table field - Central Finance Replicated Sales Document Item
▼
Description: Central Finance Replicated Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FINS_CFIN_AV_RPLD_SLS_DOC_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIN_AVCI_ITEME table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CREDACTEDFIARLI-SALESDOCUMENTITEM table field - Item Number (6 Digits)
▼
Description: Item Number (6 Digits) Field Name: SALESDOCUMENTITEM Data Element: FARP_POSN2 Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CREDACTEDFIARLI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDREVNFRMINVCQ-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDREVNFRMINVCQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDSDOCITMPEDX1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSDOCITMPEDX1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSLSPRCGCNDNRTP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSPRCGCNDNRTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EDOC_LE_BD_ITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EDOC_LE_BD_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EDOC_LE_FI_ITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EDOC_LE_FI_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_DZGLACCTBAL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZGLACCTBAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBLGITMRETBLQTY-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBLGITMRETBLQTY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICOSREVREASSGMT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICOSREVREASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICOSREVREASSITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICOSREVREASSITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICOSREVREASSITP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICOSREVREASSITP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIGLBALCMPCUBE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLBALCMPCUBE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIJOURNALENTIT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIJOURNALENTIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIOPACCTGDOCIT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIOPACCTGDOCIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPMNTFMAINTDATA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPMNTFMAINTDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPKANBANCCITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: VDM_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPKANBANCCITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPMFGORDBSCFLT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: VDM_POSNR Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMFGORDBSCFLT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRACCASMTAPI01-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCASMTAPI01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRACCTWRKITMWD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCTWRKITMWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPSMS4CBDACTANC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSMS4CBDACTANC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPSMS4CBDACTBSC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSMS4CBDACTBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPTSAFTBILLITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPTSAFTBILLITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRETAQTYOBF1708-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRETAQTYOBF1708 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISAFTJOURNALITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISAFTJOURNALITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDBILLGDOCITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILLGDOCITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDBILLGDOCITMC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILLGDOCITMC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISLSPRCDCNDNRTP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSPRCDCNDNRTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISLSPRCGRECDTMP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSPRCGRECDTMP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PBRIALLATTRIB_S-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PBRIALLATTRIB_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PEWMWHTRDOCNR01-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEWMWHTRDOCNR01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIGLACCOUNTBAL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGLACCOUNTBAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PIFIGLACOUNTBL2-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PIFIGLACOUNTBL2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPAYREQLINEITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPAYREQLINEITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_BD_SLS_ITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_BD_SLS_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
AFIOPACCTGDOCCUB-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AFIOPACCTGDOCCUB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CALGNMTSIMLNCOMP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CALGNMTSIMLNCOMP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CALIGNMENTRUNDET-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CALIGNMENTRUNDET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCNPAYTREQNLINEI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNPAYTREQNLINEI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCOSREVREASSAITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOSREVREASSAITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCUSTEXPDPRCCOND-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCUSTEXPDPRCCOND table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDSPMATVALCHFLTR-SALESDOCUMENTITEM table field - Sales Document Item in Character
▼
Description: Sales Document Item in Character Field Name: SALESDOCUMENTITEM Data Element: POSNR_CHAR Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR_CHAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDSPMATVALCHFLTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIGLACCTBALFLOW-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIGLACCTBALFLOW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIOPACCTGDCBRWS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIOPACCTGDCBRWS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFITRIALBALQ0001-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFITRIALBALQ0001 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFITRIALBALQ0002-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFITRIALBALQ0002 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
COSREVREASSITMDR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COSREVREASSITMDR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
COSREVREASS_DRFT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COSREVREASS_DRFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRHIACCTASSMTWI-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRHIACCTASSMTWI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDBDOCITMPEBCDX-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDBDOCITMPEBCDX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDBDOCITMPECDX1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDBDOCITMPECDX1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDBILDOCITMBCDX-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDBILDOCITMBCDX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDBILDOCITMBDX1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDBILDOCITMBDX1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDCUSTRETREFITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDCUSTRETREFITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_DZGLLDGRITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZGLLDGRITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_DZJOURNALENT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZJOURNALENT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAP_S_APLINEITEM-SALESDOCUMENTITEM table field - Item Number (6 Digits)
▼
Description: Item Number (6 Digits) Field Name: SALESDOCUMENTITEM Data Element: FARP_POSN2 Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAP_S_APLINEITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_S_ARLINEITEM-SALESDOCUMENTITEM table field - Item Number (6 Digits)
▼
Description: Item Number (6 Digits) Field Name: SALESDOCUMENTITEM Data Element: FARP_POSN2 Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_S_ARLINEITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IEBRRCLSGRUNRSLT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEBRRCLSGRUNRSLT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIGLACCTYTDBALC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLACCTYTDBALC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIOPACCTGDCBRWS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIOPACCTGDCBRWS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIOPACCTGDOCCUB-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIOPACCTGDOCCUB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIPLGLACCTLITST-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIPLGLACCTLITST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ILMRSTLTCOCIDIFF-SALESDOCUMENTITEM table field - Item ID
▼
Description: Item ID Field Name: SALESDOCUMENTITEM Data Element: LMD_COM_ITEM_ID Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: LMD_COM_ITEM_ID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILMRSTLTCOCIDIFF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPAYTREQNLINEITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYTREQNLINEITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRACCASGMTAPI01-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCASGMTAPI01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRHDITACTWRKITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRHDITACTWRKITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRHRITACWRKITWD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRHRITACWRKITWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROJBILLGREQITM-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJBILLGREQITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRSSPACCTASSGMT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRSSPACCTASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPSMS4CCOMACTANC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSMS4CCOMACTANC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRFMMASADOGENITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMASADOGENITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRFMMFGORDERDURN-SALESDOCUMENTITEM table field - Sales Order Item
▼
Description: Sales Order Item Field Name: SALESDOCUMENTITEM Data Element: CO_KDPOS Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMFGORDERDURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRFMPRVSNLDOCITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMPRVSNLDOCITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRFMPRVSNLGNRITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMPRVSNLGNRITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRFMPRVSNLVRITMS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMPRVSNLVRITMS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRRBSLSPRDYNITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRRBSLSPRDYNITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDBILDITMBSCANA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILDITMBSCANA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDBILDOCITMEBAS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILDOCITMEBAS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDBILLDOCITMANA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILLDOCITMANA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDPREBILDITMANA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDPREBILDITMANA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDPREBILDOCITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDPREBILDOCITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMANAGEORDERSTP-SALESDOCUMENTITEM table field - Sales Order Item
▼
Description: Sales Order Item Field Name: SALESDOCUMENTITEM Data Element: CO_KDPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMANAGEORDERSTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMANAGEORDERS_D-SALESDOCUMENTITEM table field - Sales Order Item
▼
Description: Sales Order Item Field Name: SALESDOCUMENTITEM Data Element: CO_KDPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMANAGEORDERS_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_ACC_TXTS-SALESDOCUMENTITEM table field - Item number in Sales Order
▼
Description: Item number in Sales Order Field Name: SALESDOCUMENTITEM Data Element: KDPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: NUM06 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_ACC_TXTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PR_GLACC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_CO Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_GLACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCOSREVREASSAITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCOSREVREASSAITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIGLACCTLITSTFA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGLACCTLITSTFA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIGLACCTLITSTGL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGLACCTLITSTGL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIGLACCTLITSTUN-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGLACCTLITSTUN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIOPACCTGDCBRWS-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIOPACCTGDCBRWS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PROJBILLGREQITEM-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PROJBILLGREQITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDOCITPARTCMPLT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDOCITPARTCMPLT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSDSLSDOCITMFLF5-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: VBAP Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSDOCITMFLF5 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSOFISSUESU011V2-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSOFISSUESU011V2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSOFISSUESU012V2-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSOFISSUESU012V2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSOFISSUESU013V2-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSOFISSUESU013V2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIARLINEITEM_COP-SALESDOCUMENTITEM table field - Item Number (6 Digits)
▼
Description: Item Number (6 Digits) Field Name: SALESDOCUMENTITEM Data Element: FARP_POSN2 Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIARLINEITEM_COP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCHMLCMPLNCREQTP-SALESDOCUMENTITEM table field - Item Number of a Logistics Document
▼
Description: Item Number of a Logistics Document Field Name: SALESDOCUMENTITEM Data Element: EHFND_LOG_DOC_VBELN_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: EHFND_LOG_DOC_VBELN_POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCHMLCMPLNCREQTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PR_ACCGRP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_ACCGRP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SDRO_COMPLETE-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SDRO_COMPLETE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINSS_ACCIT_FI_EXT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINSS_ACCIT_FI_EXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_ACDOC_ITEM_IN-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_ACDOC_ITEM_IN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMANAGEORDERSTP_D-SALESDOCUMENTITEM table field - Sales Order Item
▼
Description: Sales Order Item Field Name: SALESDOCUMENTITEM Data Element: CO_KDPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMANAGEORDERSTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LOIN_S_EXCISE_ITEM-SALESDOCUMENTITEM table field - Billing Item
▼
Description: Billing Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VF Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LOIN_S_EXCISE_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SSP_DRIVER-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_CO Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_DRIVER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PROJBILLGREQITEM_S-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PROJBILLGREQITEM_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_BD_SD_APM_ITEM-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_BD_SD_APM_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCHMLCMPLNCREQTP_D-SALESDOCUMENTITEM table field - Item Number of a Logistics Document
▼
Description: Item Number of a Logistics Document Field Name: SALESDOCUMENTITEM Data Element: EHFND_LOG_DOC_VBELN_POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: EHFND_LOG_DOC_VBELN_POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCHMLCMPLNCREQTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_EXT_ACC_HUB-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_ACC_HUB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EDOC_LE_BD_ITEM_DATA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EDOC_LE_BD_ITEM_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EDOC_LE_FI_ITEM_DATA-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FIS_POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EDOC_LE_FI_ITEM_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EPIC_API_S_FPRL_ITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EPIC_API_S_FPRL_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAP_IFIAPLINEITEM_EX-SALESDOCUMENTITEM table field - Item Number (6 Digits)
▼
Description: Item Number (6 Digits) Field Name: SALESDOCUMENTITEM Data Element: FARP_POSN2 Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAP_IFIAPLINEITEM_EX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_IFIARLINEITEM_EX-SALESDOCUMENTITEM table field - Item Number (6 Digits)
▼
Description: Item Number (6 Digits) Field Name: SALESDOCUMENTITEM Data Element: FARP_POSN2 Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_IFIARLINEITEM_EX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_EXT_LOCALACC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_LOCALACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_L2L3_S_L3_ITEM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_L2L3_S_L3_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_S_ARLINEITEM_RDCT-SALESDOCUMENTITEM table field - Item Number (6 Digits)
▼
Description: Item Number (6 Digits) Field Name: SALESDOCUMENTITEM Data Element: FARP_POSN2 Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_S_ARLINEITEM_RDCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_S_WUPC_SOITEM_INFO-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_WUPC_SOITEM_INFO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_CREDACTEDFIARLI_EX-SALESDOCUMENTITEM table field - Item Number (6 Digits)
▼
Description: Item Number (6 Digits) Field Name: SALESDOCUMENTITEM Data Element: FARP_POSN2 Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_CREDACTEDFIARLI_EX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSBILLINGINSTRUCTION_S-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSBILLINGINSTRUCTION_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SDOC_S_PRT_ITEM_DETAIL-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDOC_S_PRT_ITEM_DETAIL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_CMR_ITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_CMR_ITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_DMR_ITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_DMR_ITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_ITM_TXT-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_ITM_TXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMS4S_CONDITION_RECORD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_CONDITION_RECORD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_TRR_S_WORKLIST_SAL-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_TRR_S_WORKLIST_SAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SSP_PR_ITEM_ACC-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_PR_ITEM_ACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_BD_SLS_ITEM_PARTNER-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_BD_SLS_ITEM_PARTNER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_BD_SLS_SCHEDULELINE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_BD_SLS_SCHEDULELINE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_BILLPLAN-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_BILLPLAN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_BD_SLS_ITEM_EXTENDED-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_BD_SLS_ITEM_EXTENDED table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_INCOTERMS-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_INCOTERMS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TSPURCHASEREQNACCTASSGMT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNACCTASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCASSIGNMENT_WD-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCASSIGNMENT_WD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSTSTCLKEYFIGVALUEITEMTP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSTSTCLKEYFIGVALUEITEMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSLSPRCGCONDITIONRECORDTP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSTATISTICALKEYFIGVALUETP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSTATISTICALKEYFIGVALUETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_CANCEL_TERM-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_CANCEL_TERM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_CHGDOC_TEXT-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_CHGDOC_TEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_INQUIRY_ITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_INQUIRY_ITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_ITEM_CONFIG-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_ITEM_CONFIG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_REJECT_ITEM-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_REJECT_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_STATUS_ITEM-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_STATUS_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TSPURCHASEREQNACCTASSGMT_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNACCTASSGMT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAR_DP_SETTLEMENT_S_L3_ITEM-SALESDOCUMENTITEM table field - Current line of sales document
▼
Description: Current line of sales document Field Name: SALESDOCUMENTITEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAR_DP_SETTLEMENT_S_L3_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_CI_EX_ITEM_K-SALESDOCUMENTITEM table field - Central Finance Replicated Sales Document Item
▼
Description: Central Finance Replicated Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FINS_CFIN_AV_RPLD_SLS_DOC_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_CI_EX_ITEM_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCOSTREVENUEREASSIGNMENTTP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOSTREVENUEREASSIGNMENTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCASSIGNMENT_WD_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCASSIGNMENT_WD_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMTP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMTP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSLSPRCGCONDITIONRECORDTP3-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP3 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSLSPRCGCONDITIONRECORDTP4-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP4 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSTSTCLKEYFIGVALUEITEMTP_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSTSTCLKEYFIGVALUEITEMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SDBIL_BD_ITEM_DTRCK_EXCERPT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDBIL_BD_ITEM_DTRCK_EXCERPT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SDSLSPRC_APPROVAL_REQUEST_S-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDSLSPRC_APPROVAL_REQUEST_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_ITM_TXT_LINE-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_ITM_TXT_LINE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_ORDWOCHG_ITM-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_ORDWOCHG_ITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TSPURCHASEREQNACCTASSGMT_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNACCTASSGMT_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMS4S_CONDITION_RECD_VALDTY-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_CONDITION_RECD_VALDTY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_CI_EX_ITEM_DB-SALESDOCUMENTITEM table field - Central Finance Replicated Sales Document Item
▼
Description: Central Finance Replicated Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FINS_CFIN_AV_RPLD_SLS_DOC_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_CI_EX_ITEM_DB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCOSTREVNREASSIGNMENTITEMTP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOSTREVNREASSIGNMENTITEMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCASSIGNMENT_WD_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCASSIGNMENT_WD_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMTP1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMTP2-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMTP1-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSLSPRCGCONDITIONRECORDTP_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSTATISTICALKEYFIGVALUETP_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSTATISTICALKEYFIGVALUETP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSTSTCLKEYFIGVALUEITEMTP_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSTSTCLKEYFIGVALUEITEMTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_PREQUISITION_ACCTASGMT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PREQUISITION_ACCTASGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SSP_REQ_ACCTASSIGNMT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_REQ_ACCTASSIGNMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SDSLSPRC_APPROVAL_REQ_ITEM_S-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDSLSPRC_APPROVAL_REQ_ITEM_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_SCHEDULE_LINE-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_SCHEDULE_LINE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_CFIN_S_AV_CI_EX_POSITION-SALESDOCUMENTITEM table field - Central Finance Replicated Sales Document Item
▼
Description: Central Finance Replicated Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: FINS_CFIN_AV_RPLD_SLS_DOC_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_CI_EX_POSITION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMPUR_S_SSP_REQ_ACCTASSIGNMT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPUR_S_SSP_REQ_ACCTASSIGNMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCOSTREVENUEREASSIGNMENTTP_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOSTREVENUEREASSIGNMENTTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMTP_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMTP_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSLSPRCGCONDITIONRECORDTP3_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP3_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSLSPRCGCONDITIONRECORDTP4_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP4_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSLSPRCGCONDITIONRECORDTP_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSLSPRICINGCONDITIONRECORDTP-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRICINGCONDITIONRECORDTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSTATISTICALKEYFIGVALUETP_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSTATISTICALKEYFIGVALUETP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OUTLINE_MEPOACCTG_DATAX-SALESDOCUMENTITEM table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SALESDOCUMENTITEM Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLINE_MEPOACCTG_DATAX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OUTLNE_MEOUTBAPIACCOUNT-SALESDOCUMENTITEM table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SALESDOCUMENTITEM Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLNE_MEOUTBAPIACCOUNT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPDS_ODATA_SCH_SOURCEOFSUPPLY-SALESDOCUMENTITEM table field - Sales and Distribution Document Item
▼
Description: Sales and Distribution Document Item Field Name: SALESDOCUMENTITEM Data Element: /SAPAPO/CMDS_VBELP Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: NUMC6 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPDS_ODATA_SCH_SOURCEOFSUPPLY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_MCC_SDOC_ENTITY_HANDLE-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_MCC_SDOC_ENTITY_HANDLE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_ADDL_TEXT_ITEM-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_ADDL_TEXT_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMS4S_CONDITION_RECORD_ATTRIB-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_CONDITION_RECORD_ATTRIB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FML_DMVC_S_MATERIAL_ATTRIBUTES-SALESDOCUMENTITEM table field - Sales Document Item in Character
▼
Description: Sales Document Item in Character Field Name: SALESDOCUMENTITEM Data Element: POSNR_CHAR Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR_CHAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FML_DMVC_S_MATERIAL_ATTRIBUTES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCOSTREVENUEREASSIGNMENTTP_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOSTREVENUEREASSIGNMENTTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCOSTREVNREASSIGNMENTITEMTP_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOSTREVNREASSIGNMENTITEMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCOSTREVNREASSIGNMENTITEMT_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOSTREVNREASSIGNMENTITEMT_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMT1_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMT1_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMT2_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMT2_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMTP1_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP1_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMTP2_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNACCTASSGMTWRKITMTP_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMT1_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMT1_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMT2_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMT2_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMT3_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMT3_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMT4_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMT4_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMTP1_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP1_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMTP2_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMTP3_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP3_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMTP4_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP4_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURREQNHDRITMACASWRKITMTP_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSLSPRCGCONDITIONRECORDTP3_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP3_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSLSPRCGCONDITIONRECORDTP4_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP4_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSLSPRICINGCONDITIONRECORDT_D-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRICINGCONDITIONRECORDT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSLSPRICINGCONDITIONRECORD_DR-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRICINGCONDITIONRECORD_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_PR_APRVL_CMPL_S_ACCLINES-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PR_APRVL_CMPL_S_ACCLINES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PR_ACCTASSIGNMT_IMPORT-SALESDOCUMENTITEM table field - Sales Document Item
▼
Description: Sales Document Item Field Name: SALESDOCUMENTITEM Data Element: POSNR_VA Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_ACCTASSIGNMT_IMPORT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_ITMSCHDLN_TOTAL-SALESDOCUMENTITEM table field - Item number of the SD document
▼
Description: Item number of the SD document Field Name: SALESDOCUMENTITEM Data Element: POSNR Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_ITMSCHDLN_TOTAL table
|