Details |
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TLDB-SYSTEM table field - CHAR01 data element for SYST
▼
Description: CHAR01 data element for SYST Field Name: SYSTEM Data Element: SYCHAR01 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TLDB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TLDBT-SYSTEM table field - CHAR01 data element for SYST
▼
Description: CHAR01 data element for SYST Field Name: SYSTEM Data Element: SYCHAR01 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TLDBT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUF_H_CONT-SYSTEM table field - SAP system number
▼
Description: SAP system number Field Name: SYSTEM Data Element: BUFHSYSNO Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: BUFHSYSNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUF_H_CONT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUF_S_CONT-SYSTEM table field - SAP system number
▼
Description: SAP system number Field Name: SYSTEM Data Element: BUFHSYSNO Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: BUFHSYSNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUF_S_CONT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CLB_S_APPLI_DATA_DATA_EXT-SYSTEM table field - Name of SAP System
▼
Description: Name of SAP System Field Name: SYSTEM Data Element: SYSYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CLB_S_APPLI_DATA_DATA_EXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CLB2_S_APPLI_DATA_DATA_EXT-SYSTEM table field - CHAR08
▼
Description: CHAR08 Field Name: SYSTEM Data Element: CHAR08 Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: CHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CLB2_S_APPLI_DATA_DATA_EXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CATK-SYSTEM table field - CATT - System ID
▼
Description: CATT - System ID Field Name: SYSTEM Data Element: CATSYSTEM Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: CATSYSTEM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CATK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WFNV-SYSTEM table field - Workflow: SystemID of next system
▼
Description: Workflow: SystemID of next system Field Name: SYSTEM Data Element: WF_NSYSTEM Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: WF_SYSTEM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WFNV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CATFR-SYSTEM table field - CATT - System ID
▼
Description: CATT - System ID Field Name: SYSTEM Data Element: CATSYSTEM Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: CATSYSTEM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CATFR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EDPVW-SYSTEM table field - ID: Shipment entry which cannot be maintained by customer
▼
Description: ID: Shipment entry which cannot be maintained by customer Field Name: SYSTEM Data Element: SYSTEM Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EDPVW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TLSYS-SYSTEM table field - Char 20
▼
Description: Char 20 Field Name: SYSTEM Data Element: CHAR20 Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: CHAR20 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TLSYS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ATPMSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ATPMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CATFR2-SYSTEM table field - Proxy Data Element (Generated)
▼
Description: Proxy Data Element (Generated) Field Name: SYSTEM Data Element: CHAR37 Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CATFR2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WFSYST-SYSTEM table field - System
▼
Description: System Field Name: SYSTEM Data Element: SWP_REQ_SY Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WFSYST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
APPLMSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APPLMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CTSCRED-SYSTEM table field - TMS: System Name
▼
Description: TMS: System Name Field Name: SYSTEM Data Element: TMSSYSNAM Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: SYSNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTSCRED table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EMERROR-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EMERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICL_RET-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICL_RET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LISSYST-SYSTEM table field - Char 20
▼
Description: Char 20 Field Name: SYSTEM Data Element: CHAR20 Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: CHAR20 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LISSYST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TEXTLOG-SYSTEM table field - CHAR03 data element for SYST
▼
Description: CHAR03 data element for SYST Field Name: SYSTEM Data Element: SYCHAR03 Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYCHAR03 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TEXTLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
V_EDPVW-SYSTEM table field - ID: Shipment entry which cannot be maintained by customer
▼
Description: ID: Shipment entry which cannot be maintained by customer Field Name: SYSTEM Data Element: SYSTEM Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_EDPVW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIRETC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIRETC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUS_BAPI-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUS_BAPI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EMERROR1-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EMERROR1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EMERROR2-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EMERROR2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RERETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RERETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SEUICTRL-SYSTEM table field - Original System of Object
▼
Description: Original System of Object Field Name: SYSTEM Data Element: SRCSYSTEM Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: SYSNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SEUICTRL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TODORET2-SYSTEM table field - Name of SAP System
▼
Description: Name of SAP System Field Name: SYSTEM Data Element: SYSYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TODORET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TODOSICF-SYSTEM table field - Name of SAP System
▼
Description: Name of SAP System Field Name: SYSTEM Data Element: SYSYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TODOSICF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TRCOLSYS-SYSTEM table field - Logical destination (specified in function call)
▼
Description: Logical destination (specified in function call) Field Name: SYSTEM Data Element: RFCDEST Data Type: CHAR length (Dec): 32(0) Check table: * Conversion Routine: Domain Name: RFCDEST MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TRCOLSYS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TZRETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TZRETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
USER012A-SYSTEM table field - Logical destination (specified in function call)
▼
Description: Logical destination (specified in function call) Field Name: SYSTEM Data Element: RFCDEST Data Type: CHAR length (Dec): 32(0) Check table: * Conversion Routine: Domain Name: RFCDEST MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP USER012A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
USOUTTAB-SYSTEM table field - RFC sending system
▼
Description: RFC sending system Field Name: SYSTEM Data Element: RFCSENDSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP USOUTTAB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WCSALV32-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WCSALV32 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIRET24-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: CHAR108 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIRET24 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIRET25-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: CHAR108 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIRET25 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUSSDELNO-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUSSDELNO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CATSERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CATSERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCHRS_ABS-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHRS_ABS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CLMS_ITEM-SYSTEM table field - Text
▼
Description: Text Field Name: SYSTEM Data Element: CLMS_MESSAGE_SYSTEM_WS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CLMS_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
HRRFCINFO-SYSTEM table field - Logical destination (specified in function call)
▼
Description: Logical destination (specified in function call) Field Name: SYSTEM Data Element: RFCDEST Data Type: CHAR length (Dec): 32(0) Check table: * Conversion Routine: Domain Name: RFCDEST MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRRFCINFO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PTEXERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PTEXERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TMSIMITEM-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: TMSFSYSL Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TMSIMITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TRSTATLOG-SYSTEM table field - System name
▼
Description: System name Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TRSTATLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TYP_F_ECH-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TYP_F_ECH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WISO_WARN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WISO_WARN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
APPLMSG_CO-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APPLMSG_CO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPICRMMSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPICRMMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIE1RET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIE1RET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIRET212-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: CHAR1028 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIRET212 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIRET214-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: CHAR1017 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIRET214 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIRET219-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: CHAR1029 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIRET219 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIRET223-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: CHAR1039 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIRET223 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPISDXTR2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPISDXTR2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPITRKRET-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPITRKRET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BPAKRETURN-SYSTEM table field - Character Field with Length 10
▼
Description: Character Field with Length 10 Field Name: SYSTEM Data Element: CHAR10 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: CHAR10 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BPAKRETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUS_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUS_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CIFBAPIRET-SYSTEM table field - Logical System of Sender
▼
Description: Logical System of Sender Field Name: SYSTEM Data Element: SYS_VON Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CIFBAPIRET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CTS_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTS_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DB2MONIKEY-SYSTEM table field - System
▼
Description: System Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DB2MONIKEY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
E1BPE1RET2-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E1BPE1RET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
E1BPSDXTR2-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E1BPSDXTR2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
GFC_CONP46-SYSTEM table field - Graphical fullscreen: Connection parameter System ID
▼
Description: Graphical fullscreen: Connection parameter System ID Field Name: SYSTEM Data Element: SCRFSYSTEM Data Type: CHAR length (Dec): 16(0) Check table: Conversion Routine: Domain Name: SYCHAR16 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GFC_CONP46 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
GFC_CONPAR-SYSTEM table field - Graphical fullscreen: Connection parameter System ID
▼
Description: Graphical fullscreen: Connection parameter System ID Field Name: SYSTEM Data Element: SCRFSYSTEM Data Type: CHAR length (Dec): 16(0) Check table: Conversion Routine: Domain Name: SYCHAR16 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GFC_CONPAR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MATRETURN2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MATRETURN2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PTLRPERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PTLRPERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SBF_CHKRES-SYSTEM table field - Name of SAP System
▼
Description: Name of SAP System Field Name: SYSTEM Data Element: SYSYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SBF_CHKRES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TMSCSYSEXT-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: TMSCSYS Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TMSCSYSEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TMSCSYSORG-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: TMSCSYS Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TMSCSYSORG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIRETASYN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIRETASYN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIRET_WRK-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIRET_WRK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUSLOCALMSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUSLOCALMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CTSCITARGET-SYSTEM table field - TMS: System Name
▼
Description: TMS: System Name Field Name: SYSTEM Data Element: TMSSYSNAM Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: SYSNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTSCITARGET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DPWTY_S_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DPWTY_S_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
E1BPRETASYN-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E1BPRETASYN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
E1EDL20RET2-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E1EDL20RET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
E1EDL24RET2-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E1EDL24RET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ECATT_CATFR-SYSTEM table field - Proxy Data Element (Generated)
▼
Description: Proxy Data Element (Generated) Field Name: SYSTEM Data Element: ECATT_CHAR3 Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ECATT_CATFR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ETPERF_TSYS-SYSTEM table field - Target System (Key in System Data Container)
▼
Description: Target System (Key in System Data Container) Field Name: SYSTEM Data Element: ETCMP_CMP Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: CHAR30 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ETPERF_TSYS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INFO_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INFO_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPM_BAPIRET-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPM_BAPIRET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISU_APPLMSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISU_APPLMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OIB_EMSEGO2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OIB_EMSEGO2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSB_API_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSB_API_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RCGEXTERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCGEXTERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
USAUTHVALUE-SYSTEM table field - Logical destination (specified in function call)
▼
Description: Logical destination (specified in function call) Field Name: SYSTEM Data Element: RFCDEST Data Type: CHAR length (Dec): 32(0) Check table: * Conversion Routine: Domain Name: RFCDEST MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP USAUTHVALUE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WISO_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WISO_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WSRS_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WSRS_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIRET2_FIX-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIRET2_FIX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIRETASYNC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIRETASYNC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUSLOCALMSG1-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUSLOCALMSG1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUSLOCALMSG2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUSLOCALMSG2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUSREMOTEMSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUSREMOTEMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUS_PCA_BAPI-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUS_PCA_BAPI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCHRS_FAMILY-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHRS_FAMILY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPFS_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPFS_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
E101BAPIRET2-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E101BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
E102BAPIRET2-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E102BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EDESK_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EDESK_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESE_FEH_CASE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESE_FEH_CASE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKK_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFM_OIRETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFM_OIRETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PIQ_SF_ERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PIQ_SF_ERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRIT_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRIT_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SXMS_MSG_RET-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SXMS_MSG_RET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UJN_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UJN_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ATL/BAPIRET2-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: /ATL/CHAR10 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ATL/BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUSREMOTEMSG1-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUSREMOTEMSG1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUSREMOTEMSG2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUSREMOTEMSG2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCHRS_ADDRESS-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHRS_ADDRESS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCHRS_ORGDATA-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHRS_ORGDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CLMS_BAPIRET2-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: CLMS_CHAR10 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CLMS_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_SI_ERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_SI_ERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CVP_S_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CVP_S_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EDESK_RETURN1-SYSTEM table field - Proxy Data Element (Generated)
▼
Description: Proxy Data Element (Generated) Field Name: SYSTEM Data Element: CHAR102 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EDESK_RETURN1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_FACET-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_FACET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PIQCA_BAL_LOG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PIQCA_BAL_LOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RPO_S_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPO_S_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SYPP_MAPIRET2-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SYPP_MAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TYP_F_BUSSEQU-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TYP_F_BUSSEQU table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TYP_F_ECH_PPO-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TYP_F_ECH_PPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_S_AUFART-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_S_AUFART table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_S_SYSTEM-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_S_SYSTEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WLBI_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WLBI_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/IPRO/BAPIRET2-SYSTEM table field - Proxy Data Element (Generated)
▼
Description: Proxy Data Element (Generated) Field Name: SYSTEM Data Element: /IPRO/CHAR10 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /IPRO/BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PICM/BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PICM/BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PRA/P2_FI_ERR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PRA/P2_FI_ERR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SHCM/EMPLOYEE-SYSTEM table field - LANGUAGE INDEPENDENT LONG Name
▼
Description: LANGUAGE INDEPENDENT LONG Name Field Name: SYSTEM Data Element: /SHCM/SYSTEM_ID Data Type: CHAR length (Dec): 80(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SHCM/EMPLOYEE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_VBKA_BOID-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: TBDLS Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_VBKA_BOID table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BCFG_EXCEPTION-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BCFG_EXCEPTION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BIZC_EP_SYSTEM-SYSTEM table field - BIZC. String
▼
Description: BIZC. String Field Name: SYSTEM Data Element: BIZC_STRING Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BIZC_EP_SYSTEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCHRS_PERSDATA-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHRS_PERSDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
COWORK_TASKLOG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COWORK_TASKLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_CMG_ERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_CMG_ERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRM_SC_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRM_SC_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CTS_TRTOOL_LOG-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: IF_CTS_SYSTEM Data Type: REF length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTS_TRTOOL_LOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CVIS_BP_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CVIS_BP_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_MU_LOGIN-SYSTEM table field - System
▼
Description: System Field Name: SYSTEM Data Element: ESH_E_MU_SYSTEM Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_MU_LOGIN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ETLOG_SYS_DEST-SYSTEM table field - Target System (Key in System Data Container)
▼
Description: Target System (Key in System Data Container) Field Name: SYSTEM Data Element: ETCMP_CMP Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: CHAR30 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ETLOG_SYS_DEST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LESHP_00001525-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LESHP_00001525 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LESHP_00002232-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LESHP_00002232 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LESHP_00002280-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LESHP_00002280 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LESHP_00002443-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LESHP_00002443 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LESHP_00002521-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LESHP_00002521 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LESHP_00002569-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LESHP_00002569 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MCW_AA_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCW_AA_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OBOM_WB_S_PRM2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OBOM_WB_S_PRM2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OBOM_WB_S_PRM5-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OBOM_WB_S_PRM5 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RCGHEXBAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCGHEXBAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TYP_F_ECH_FAIL-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TYP_F_ECH_FAIL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_CCTR_LIST-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_CCTR_LIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UPS_S_MESSAGES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UPS_S_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WSTI_CALC_LIST-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WSTI_CALC_LIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/AIF/BAPIE1RET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /AIF/BAPIE1RET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/BDL/BUF_H_CONT-SYSTEM table field - SAP system number
▼
Description: SAP system number Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /BDL/BUF_H_CONT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/OSP/ERROR_INFO-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /OSP/ERROR_INFO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PM0/3FJ_PPOLOG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PM0/3FJ_PPOLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SPE/E1BAPIRET2-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SPE/E1BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SPE/E2BAPIRET2-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SPE/E2BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPISCMBRETASYN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPISCMBRETASYN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_ALM_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_ALM_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_BMUOM_DATA-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: TBDLS Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_BMUOM_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_MATRETURN2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_MATRETURN2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BTC_S_EXT_QUEUE-SYSTEM table field - ExtSdl: Name of an External System
▼
Description: ExtSdl: Name of an External System Field Name: SYSTEM Data Element: BTC_EXT_SDL_SYSTEM Data Type: CHAR length (Dec): 80(0) Check table: Conversion Routine: Domain Name: DBTC_EXT_SDL_NAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BTC_S_EXT_QUEUE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
COMT_WEC_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COMT_WEC_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_ATTR_ERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_ATTR_ERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_CMG_PROMPT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_CMG_PROMPT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DMC_FM_MESSAGES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DMC_FM_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
E1BPSCMBRETASYN-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E1BPSCMBRETASYN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
E1BP_MATRETURN2-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E1BP_MATRETURN2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EDATEXESAMSGLOG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EDATEXESAMSGLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_MU_ASSIST-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: ESH_S_MU_ASSIST_VH_SYSTEM Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_MU_ASSIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_MU_ASSIST-SYSTEM table field - Text, Length 30
▼
Description: Text, Length 30 Field Name: SYSTEM Data Element: ESH_E_MU_TEXT30 Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: ESH_D_MU_TEXT30 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_MU_ASSIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_MU_ASSIST-SYSTEM table field - Text, Length 30
▼
Description: Text, Length 30 Field Name: SYSTEM Data Element: ESH_E_MU_TEXT30 Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: ESH_D_MU_TEXT30 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_MU_ASSIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_MU_ASSIST-SYSTEM table field - Text, Length 30
▼
Description: Text, Length 30 Field Name: SYSTEM Data Element: ESH_E_MU_TEXT30 Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: ESH_D_MU_TEXT30 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_MU_ASSIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_UT_SYSTEM-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_UT_SYSTEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EWA_EHSERRORTAB-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWA_EHSERRORTAB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
HRESS_S_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRESS_S_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
HRPAYBRBAPIRET2-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: HRPAYBRCHAR10 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRPAYBRBAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
HRPP_WSBAPIRET2-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: PCPO_WSCHAR10 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRPP_WSBAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
JVA_MESSAGE_JOA-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP JVA_MESSAGE_JOA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NJIT_CONFP_LOGS-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NJIT_CONFP_LOGS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OSPWDATA_SOURCE-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OSPWDATA_SOURCE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RAIP_CONS_CHECK-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RAIP_CONS_CHECK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RCGEXTERRORGUID-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCGEXTERRORGUID table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TMW_TP_I2NALERT-SYSTEM table field - TMS: System Name
▼
Description: TMS: System Name Field Name: SYSTEM Data Element: TMSSYSNAM Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: SYSNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TMW_TP_I2NALERT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TYP_F_ECH_INPUT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TYP_F_ECH_INPUT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_CELEM_DATA-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_CELEM_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_S_CELEM_TI-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_S_CELEM_TI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_S_CORRPOST-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_S_CORRPOST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WSTI_WD_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WSTI_WD_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WTYSC_MSG_STRUC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WTYSC_MSG_STRUC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/OSP/DATA_SOURCE-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /OSP/DATA_SOURCE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PM0/ABT_SVC_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PM0/ABT_SVC_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PRA/P2_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PRA/P2_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SMB/S_EXCEPTION-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SMB/S_EXCEPTION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/UI2/CDM_STARTUP-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /UI2/CDM_STARTUP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
AGRDIST_MESSAGES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AGRDIST_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
APO_BAPI_OBJDATA-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APO_BAPI_OBJDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIE1MATRETURN2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIE1MATRETURN2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_CONF_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_CONF_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_CORU_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_CORU_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BTC_S_EXT_SDL_F4-SYSTEM table field - ExtSdl: Name of an External System
▼
Description: ExtSdl: Name of an External System Field Name: SYSTEM Data Element: BTC_EXT_SDL_SYSTEM Data Type: CHAR length (Dec): 80(0) Check table: Conversion Routine: Domain Name: DBTC_EXT_SDL_NAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BTC_S_EXT_SDL_F4 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNVMBTSPLEVELS_S-SYSTEM table field - Technical Object Name
▼
Description: Technical Object Name Field Name: SYSTEM Data Element: CNVMBTOBJNAME Data Type: CHAR length (Dec): 32(0) Check table: Conversion Routine: Domain Name: CNVMBTOBJNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNVMBTSPLEVELS_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPE_SPQ_CNDN_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPE_SPQ_CNDN_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_BTMF_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_BTMF_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_DDF_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_DDF_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_EOP_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_EOP_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_EVENT_RCODE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_EVENT_RCODE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CURTO_RTO_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CURTO_RTO_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CUSTMAT_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CUSTMAT_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
E1BP_CORU_RETURN-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E1BP_CORU_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHSBS_RC_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHSBS_RC_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKDPR_S_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKDPR_S_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FPMGB_S_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FPMGB_S_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FSBP_PRX_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FSBP_PRX_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FSL_STR_ECH_DATA-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FSL_STR_ECH_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFM_CCF_MESSAGES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFM_CCF_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFM_CCL_MESSAGES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFM_CCL_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFM_CCOVR_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFM_CCOVR_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISALES_SEL_ERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISALES_SEL_ERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MDG_BS_BP_MSGMAP-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDG_BS_BP_MSGMAP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OIJ_NOM_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OIJ_NOM_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PTRV_POST_RESULT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PTRV_POST_RESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SCMI_ACT_LOG_NEW-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCMI_ACT_LOG_NEW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SCMI_CCV_RESULTS-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCMI_CCV_RESULTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SCWB_PUSH_SYSTEM-SYSTEM table field - Character Field with Length 10
▼
Description: Character Field with Length 10 Field Name: SYSTEM Data Element: CHAR10 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: CHAR10 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCWB_PUSH_SYSTEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SHP_BULK_RETURNS-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SHP_BULK_RETURNS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SIM_RSUSR200_ALV-SYSTEM table field - Receiving system for central user administration
▼
Description: Receiving system for central user administration Field Name: SYSTEM Data Element: RFCRCVSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SIM_RSUSR200_ALV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_S_CCTR_TIME-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_S_CCTR_TIME table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_S_PCTR_TIME-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_S_PCTR_TIME table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/AIF/S_MSG_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /AIF/S_MSG_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_COA-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_COA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_UOM-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_UOM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/RPM/TS_ITEM_D_UI-SYSTEM table field - Type of Linked Object
▼
Description: Type of Linked Object Field Name: SYSTEM Data Element: DPR_TV_OBL_TYPE Data Type: CHAR length (Dec): 15(0) Check table: * Conversion Routine: Domain Name: DPR_OBL_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /RPM/TS_ITEM_D_UI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/TR_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/TR_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SEHS/BAS_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SEHS/BAS_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SEHS/DGS_CHKFMSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SEHS/DGS_CHKFMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SMB/BSI_MESSAGE1-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: /SMB/CHAR102 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SMB/BSI_MESSAGE1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ACE_ACCDOC_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACE_ACCDOC_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ACE_ACEDOC_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACE_ACEDOC_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ADPIC_S_ERROR_LOG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ADPIC_S_ERROR_LOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIVEHICLERETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIVEHICLERETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_ORDER_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_ORDER_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_VBKA_BOIDREF-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: TBDLS Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_VBKA_BOIDREF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BTP_PCI_S_RFCDEST-SYSTEM table field - System ID
▼
Description: System ID Field Name: SYSTEM Data Element: RFCSYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BTP_PCI_S_RFCDEST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BTP_SMI_S_RFCDEST-SYSTEM table field - BTP SMSY System Name
▼
Description: BTP SMSY System Name Field Name: SYSTEM Data Element: BTP_SMI_SMSY_SYSTEMNAME Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: BTP_SMI_SMSY_SYSTEMNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BTP_SMI_S_RFCDEST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CAT_PINGRESPONSE1-SYSTEM table field - Proxy Data Element (Generated)
▼
Description: Proxy Data Element (Generated) Field Name: SYSTEM Data Element: CHAR37 Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CAT_PINGRESPONSE1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNVMBTDESTSTATE_S-SYSTEM table field - Technical Object Name
▼
Description: Technical Object Name Field Name: SYSTEM Data Element: CNVMBTOBJNAME Data Type: CHAR length (Dec): 32(0) Check table: Conversion Routine: Domain Name: CNVMBTOBJNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNVMBTDESTSTATE_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
COMT_CFGM_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COMT_CFGM_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMS4S_BIL_ERRORS-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_BIL_ERRORS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMS4S_DCD_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_DCD_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_PS_CAP_ERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_PS_CAP_ERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EDESK_RETURN_COMM-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EDESK_RETURN_COMM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCS_COD_IPCMSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCS_COD_IPCMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCS_MESSAGE_CP-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCS_MESSAGE_CP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESE_FEH_CASE_INFO-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESE_FEH_CASE_INFO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ETLOG_SYSTEM_DATA-SYSTEM table field - Name of SAP System
▼
Description: Name of SAP System Field Name: SYSTEM Data Element: SYSYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ETLOG_SYSTEM_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ETLOG_SYSTEM_INFO-SYSTEM table field - Name of SAP System
▼
Description: Name of SAP System Field Name: SYSTEM Data Element: SYSYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ETLOG_SYSTEM_INFO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ETLOG_SYSTEM_LIST-SYSTEM table field - Name of SAP System
▼
Description: Name of SAP System Field Name: SYSTEM Data Element: SYSYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ETLOG_SYSTEM_LIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FICOS_AUTH_RESULT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FICOS_AUTH_RESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FS4MIG_S_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FS4MIG_S_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
GENCAS_GRCLMN_ALV-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GENCAS_GRCLMN_ALV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
HREOP_S_PERNR_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HREOP_S_PERNR_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MDM_CLF_S_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDM_CLF_S_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_CAT_S_SCOPE-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CAT_S_SCOPE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MSR_S_LFE_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MSR_S_LFE_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NFE_ERROR_DISPLAY-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NFE_ERROR_DISPLAY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFM_S_PAP_LOG_RET-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFM_S_PAP_LOG_RET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPPLDORDER_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPPLDORDER_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RPLM_S_MESSAGELOG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPLM_S_MESSAGELOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SCTC_SC_S_TR_PATH-SYSTEM table field - Name of an SAP System in the (active) transp. configuration
▼
Description: Name of an SAP System in the (active) transp. configuration Field Name: SYSTEM Data Element: SYSNAME Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: SYSNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCTC_SC_S_TR_PATH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SXCO_S_CALL_STACK-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: SYS_CALLST Data Type: TTYP length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SXCO_S_CALL_STACK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TYP_F_ECH_SYMPTOM-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TYP_F_ECH_SYMPTOM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_S_IS_PP_CCTR-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_S_IS_PP_CCTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_S_IS_PP_PCTR-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_S_IS_PP_PCTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WSTP_BAPIRET2_ACC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WSTP_BAPIRET2_ACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/AIF/LICENSE_CHECK-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /AIF/LICENSE_CHECK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_COA-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_COA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_UOM-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_UOM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CCTR-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CCTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_PCTR-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_PCTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/ET_VTOG_RC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/ET_VTOG_RC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/ET_VTOS_RC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/ET_VTOS_RC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/PPM_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/PPM_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPCND/GEN_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPCND/GEN_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SEHS/BAS_EXTERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SEHS/BAS_EXTERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SPE/BAPIDLVLOGREP-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SPE/BAPIDLVLOGREP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMFDOR_S_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMFDOR_S_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMM_DEND_PROC_LOGS-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_DEND_PROC_LOGS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMM_LREV_S_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_LREV_S_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_ISALES_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_ISALES_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DPR_R3DMS_TS_CACHE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DPR_R3DMS_TS_CACHE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHFNDS_EHS_API_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHFNDS_EHS_API_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHHSSS_RAS_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHHSSS_RAS_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHSBS_LOGPARAMBAPI-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHSBS_LOGPARAMBAPI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_IF_INA_FACET-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_IF_INA_FACET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_IF_INA_SCOPE-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_IF_INA_SCOPE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_MU_IMPORT_DS-SYSTEM table field - System
▼
Description: System Field Name: SYSTEM Data Element: ESH_E_MU_SYSTEM Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_MU_IMPORT_DS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_MU_IMPORT_FM-SYSTEM table field - System
▼
Description: System Field Name: SYSTEM Data Element: ESH_E_MU_SYSTEM Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_MU_IMPORT_FM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FCCX_UI_TSKPAR_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCCX_UI_TSKPAR_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FIN_CFIN_S_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FIN_CFIN_S_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FITV_BAPIRET2_INFO-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FITV_BAPIRET2_INFO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
HRASR00MSP_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRASR00MSP_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISU_C4C_BAPIRET2_S-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISU_C4C_BAPIRET2_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LTR2_UI_S_STEPLIST-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 7(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LTR2_UI_S_STEPLIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MICE_REPAIR_OBJECT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MICE_REPAIR_OBJECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SEARCH_LOG-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SEARCH_LOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SSP_DRIVER-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_DRIVER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OLR3_DMS_TS_FOLDER-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OLR3_DMS_TS_FOLDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
POC_FAC_S_KPI_INST-SYSTEM table field - Process Facade : System Identifier
▼
Description: Process Facade : System Identifier Field Name: SYSTEM Data Element: POC_FAC_SYSTEM Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POC_FAC_S_KPI_INST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SLIM3_S_SID_EXPORT-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: SLIM3_S_SYSTEM Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SLIM3_S_SID_EXPORT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_CCTRSTDH_DATA-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_CCTRSTDH_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_SF_IS_PP_PCTR-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_SF_IS_PP_PCTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_ST_IS_PP_PCTR-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_ST_IS_PP_PCTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/BCV/S_SIN_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /BCV/S_SIN_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/CFG/S_DATA_CONTEXT-SYSTEM table field - String
▼
Description: String Field Name: SYSTEM Data Element: /CFG/DE_STRING Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: /CFG/D_STRING MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /CFG/S_DATA_CONTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CCTR-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CCTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_PCTR-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_PCTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CELEM-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CELEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CODOC-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CODOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/RPM/TS_ITEM_KEY_IN-SYSTEM table field - Type of Linked Object
▼
Description: Type of Linked Object Field Name: SYSTEM Data Element: DPR_TV_OBL_TYPE Data Type: CHAR length (Dec): 15(0) Check table: Conversion Routine: Domain Name: DPR_OBL_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /RPM/TS_ITEM_KEY_IN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/FOT_MSG_STR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/FOT_MSG_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCMB/LOC_S_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/LOC_S_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCMB/S_IO_WUF_TSPP-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/S_IO_WUF_TSPP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCMB/S_IO_WUF_ZONE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/S_IO_WUF_ZONE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
APB_LPD_S_UNIT_TEST-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APB_LPD_S_UNIT_TEST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
APOC_S_BAPIRET2_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APOC_S_BAPIRET2_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_VBKA_OBJREF_CR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: TBDLS Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_VBKA_OBJREF_CR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BTP_SMI_S_SYSCLIENT-SYSTEM table field - BTP SMSY System Name
▼
Description: BTP SMSY System Name Field Name: SYSTEM Data Element: BTP_SMI_SMSY_SYSTEMNAME Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: BTP_SMI_SMSY_SYSTEMNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BTP_SMI_S_SYSCLIENT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_ATTR_OBJ_ERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_ATTR_OBJ_ERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_CMG_ATTR_ERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_CMG_ATTR_ERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_CMG_GUID_ERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_CMG_GUID_ERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_MKTTG_MESSAGES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_MKTTG_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_PS_SSPAP_ERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_PS_SSPAP_ERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DPR_R3DMS_TS_FOLDER-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DPR_R3DMS_TS_FOLDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCS_CHECK_RESULT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCS_CHECK_RESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_MU_IMPORT_TAB-SYSTEM table field - System
▼
Description: System Field Name: SYSTEM Data Element: ESH_E_MU_SYSTEM Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_MU_IMPORT_TAB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
HRALEOX_ERROR_STRUC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRALEOX_ERROR_STRUC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICL_FAILER_LOG_S_UI-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICL_FAILER_LOG_S_UI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
JVA_CUTBACK_POSTING-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP JVA_CUTBACK_POSTING table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LAW2_S_GROUP_SYS_UI-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: LAW2_S_SYSTEM Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LAW2_S_GROUP_SYS_UI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LISEXC_004_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LISEXC_004_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MATDET_001_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MATDET_001_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_CONSIGNMENT_UI-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_CONSIGNMENT_UI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_S_MASS_CHNG_UI-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_S_MASS_CHNG_UI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_RESP_SEARCH-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_RESP_SEARCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PTREQ_MESSAGE_STRUC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PTREQ_MESSAGE_STRUC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RLFW_S_SCHEDULE_OUT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RLFW_S_SCHEDULE_OUT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_STF_IS_PP_PCTR-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_STF_IS_PP_PCTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_S_CORRPOST_SYS-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_S_CORRPOST_SYS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_S_IS_PP_AD_FAX-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_S_IS_PP_AD_FAX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_S_IS_PP_AD_TEL-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_S_IS_PP_AD_TEL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WS2_BTC_S_EXT_QUEUE-SYSTEM table field - Proxy Data Element (Generated)
▼
Description: Proxy Data Element (Generated) Field Name: SYSTEM Data Element: WS2_CHAR80 Data Type: CHAR length (Dec): 80(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WS2_BTC_S_EXT_QUEUE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WTYSC_WWB_MSG_STRUC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WTYSC_WWB_MSG_STRUC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CELEM-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CELEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CODOC-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CODOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_ACCGAN-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_ACCGAN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_ACCGRP-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_ACCGRP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_AD_FAX-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_AD_FAX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_AD_TEL-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_AD_TEL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_COAREA-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_COAREA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_COITEM-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_COITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PLMPCV/SIN_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMPCV/SIN_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PM0/ABX_POL_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PM0/ABX_POL_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/RPM/TS_ITEM_CONTEXT-SYSTEM table field - Type of Linked Object
▼
Description: Type of Linked Object Field Name: SYSTEM Data Element: DPR_TV_OBL_TYPE Data Type: CHAR length (Dec): 15(0) Check table: Conversion Routine: Domain Name: DPR_OBL_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /RPM/TS_ITEM_CONTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPCND/CALL_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPCND/CALL_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCMB/S_IO_WUF_ROUTE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/S_IO_WUF_ROUTE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ATO_S_TASK_UI_FIELDS-SYSTEM table field - Name of an SAP System in the (active) transp. configuration
▼
Description: Name of an SAP System in the (active) transp. configuration Field Name: SYSTEM Data Element: SYSNAME Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: SYSNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ATO_S_TASK_UI_FIELDS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIAPORETURNGETCALL-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIAPORETURNGETCALL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_ECM_ORDER_ADMIN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_ECM_ORDER_ADMIN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_VBKA_BINRELSHIP-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: TBDLS Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_VBKA_BINRELSHIP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BCA_STR_FSL_ECH_DATA-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BCA_STR_FSL_ECH_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BIZC_INST_SC_PER_SYS-SYSTEM table field - Name of SAP System
▼
Description: Name of SAP System Field Name: SYSTEM Data Element: SYSYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BIZC_INST_SC_PER_SYS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BTP_SMI_S_PRODSYSTEM-SYSTEM table field - BTP SMSY System Name
▼
Description: BTP SMSY System Name Field Name: SYSTEM Data Element: BTP_SMI_SMSY_SYSTEMNAME Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: BTP_SMI_SMSY_SYSTEMNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BTP_SMI_S_PRODSYSTEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CIF_CURTO_RTO_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CIF_CURTO_RTO_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMS_MKTPL_PURCH_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS_MKTPL_PURCH_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMS_PS_4S_ERP_ERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS_PS_4S_ERP_ERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_ACT_JRNL_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_ACT_JRNL_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRM_DWP_CHECK_RESULT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRM_DWP_CHECK_RESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRM_LRP_CHECK_RESULT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRM_LRP_CHECK_RESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCS_COD_IPCMSG_DT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCS_COD_IPCMSG_DT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAA_ES_S_MD_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAA_ES_S_MD_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAA_IS_S_MD_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAA_IS_S_MD_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FMCA_RELATED_SERVICE-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMCA_RELATED_SERVICE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
GHO_S_ALERT_MESSAGES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GHO_S_ALERT_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDE_TLS_DSPL_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDE_TLS_DSPL_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
KBAS_S_PROXY_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP KBAS_S_PROXY_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SUGGEST_CONN-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SUGGEST_CONN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRCT_EXCLUSION_TRACE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRCT_EXCLUSION_TRACE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRCT_EXCLUSION_TRACE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRCT_EXCLUSION_TRACE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PTRV_WEB_EES_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PTRV_WEB_EES_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
QNCOMPLNT_AFFOBJ_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QNCOMPLNT_AFFOBJ_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SQLMDATASELECTFILTER-SYSTEM table field - Y -System
▼
Description: Y -System Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SQLMDATASELECTFILTER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TYP_F_ECHTEST_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TYP_F_ECHTEST_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_SF_IS_PP_AD_FAX-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_SF_IS_PP_AD_FAX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_SF_IS_PP_AD_TEL-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_SF_IS_PP_AD_TEL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ACCGO/S_ABD_MESSAGES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ACCGO/S_ABD_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/CFG/S_DATA_CATALOGUE-SYSTEM table field - String
▼
Description: String Field Name: SYSTEM Data Element: /CFG/DE_STRING Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: /CFG/D_STRING MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /CFG/S_DATA_CATALOGUE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/IBS/SRB_AMBAPIRETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /IBS/SRB_AMBAPIRETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_ACCGAN-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_ACCGAN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_ACCGRP-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_ACCGRP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_AD_FAX-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_AD_FAX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_AD_TEL-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_AD_TEL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_COAREA-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_COAREA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_COITEM-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_COITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_COAREA-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_COAREA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_ACCGL_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_ACCGL_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_ACCOUNT-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_ACCOUNT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_BNK_ACT-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_BNK_ACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_COMPANY-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_COMPANY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_PCCCASS-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_PCCCASS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PF1/STR_BC_AM_RETURN-SYSTEM table field - AM: System (Logical System) Where Message Originated
▼
Description: AM: System (Logical System) Where Message Originated Field Name: SYSTEM Data Element: /PF1/DTE_BC_LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: /PF1/DOM_BC_LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PF1/STR_BC_AM_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PRA/S_PP_BAPIRET2_RF-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PRA/S_PP_BAPIRET2_RF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/EXCHG_PFH_RET-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/EXCHG_PFH_RET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/EXCHG_PFR_RET-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/EXCHG_PFR_RET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/LOC_ERROR_STR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/LOC_ERROR_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCMB/S_RG_OBJECT_OUT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/S_RG_OBJECT_OUT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCWM/S_MATID_BAPIRET-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCWM/S_MATID_BAPIRET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SPE/FILTERED_MSG_STR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SPE/FILTERED_MSG_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ALM_ME_SYNC_PARAMETER-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ALM_ME_SYNC_PARAMETER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ARBFND_S_BAPIRET2_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARBFND_S_BAPIRET2_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIAPORETURNGETCALL2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIAPORETURNGETCALL2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_BMUOM_RECIPIENTS-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: TBDLS Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_BMUOM_RECIPIENTS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_VBKA_BINRELSHIPX-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: TBDLS Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_VBKA_BINRELSHIPX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CACS_S_TRANSF_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACS_S_TRANSF_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCHRS_SOCIALINSURANCE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHRS_SOCIALINSURANCE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPE_SPQ_COMMODITY_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPE_SPQ_COMMODITY_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMOST_GENSTATUS_LIST-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMOST_GENSTATUS_LIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_CMG_INTERACTIONS-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_CMG_INTERACTIONS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRM_ISX_CTR_RA_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRM_ISX_CTR_RA_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DCS_SEND_REQUEST_TYPE-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DCS_SEND_REQUEST_TYPE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EDOC_BR_ERROR_DISPLAY-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EDOC_BR_ERROR_DISPLAY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHFNDS_PARTY_ABS_DATA-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHFNDS_PARTY_ABS_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FEH_TEST_MSG_MESSAGES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FEH_TEST_MSG_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FSBP_MESSAGE_ENHANCED-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FSBP_MESSAGE_ENHANCED table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LAW2_S_DATASET_NESTED-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: LAW2_T_SYSTEM Data Type: TTYP length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LAW2_S_DATASET_NESTED table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MICE_REPAIR_ERROR_OBJ-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MICE_REPAIR_ERROR_OBJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_SI_S_EXT_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_SI_S_EXT_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_CAT_ESH_S_FACET-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CAT_ESH_S_FACET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_CAT_ESH_S_SCOPE-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CAT_ESH_S_SCOPE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_RESP_METADATA-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_RESP_METADATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SSP_RESULTSET-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_RESULTSET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
POC_FAC_S_BUS_OBJ_REF-SYSTEM table field - Process Facade : System Identifier
▼
Description: Process Facade : System Identifier Field Name: SYSTEM Data Element: POC_FAC_SYSTEM Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POC_FAC_S_BUS_OBJ_REF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PRCS_CPF_MESSAGE_LINE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRCS_CPF_MESSAGE_LINE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RFC_ALLOC_MESSAGE_OUT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RFC_ALLOC_MESSAGE_OUT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_PRODAVAILYCK_NOTE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_PRODAVAILYCK_NOTE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_S_IS_PP_AD_EMAIL-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_S_IS_PP_AD_EMAIL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_S_IS_PP_INTORDER-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_S_IS_PP_INTORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_APC_PLIST_LOG_STY-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_APC_PLIST_LOG_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_REF_NEXT_STEP_STY-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_REF_NEXT_STEP_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_REF_NEXT_STEP_STY-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_REF_NEXT_STEP_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/AIF/S_ALERT_DATA_CPWF-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /AIF/S_ALERT_DATA_CPWF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/CFG/S_WEBASSI_CONTEXT-SYSTEM table field - String
▼
Description: String Field Name: SYSTEM Data Element: /CFG/DE_STRING Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: /CFG/D_STRING MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /CFG/S_WEBASSI_CONTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_ACCGL_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_ACCGL_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_ACCOUNT-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_ACCOUNT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_BNK_ACT-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_BNK_ACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_COMPANY-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_COMPANY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_PCCCASS-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_PCCCASS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_COAREA-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_COAREA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_ACCCCDET-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_ACCCCDET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_AD_EMAIL-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_AD_EMAIL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CCTRSTDH-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CCTRSTDH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CCTRTIME-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CCTRTIME table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_COADJPST-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_COADJPST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_COMPCODE-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_COMPCODE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CURRENCY-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CURRENCY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CUST_BNK-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CUST_BNK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_FUNCAREA-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_FUNCAREA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_INTORDER-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_INTORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_PCTRSTDH-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_PCTRSTDH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_PCTRTIME-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_PCTRTIME table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_VEND_BNK-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_VEND_BNK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/ET_VTOGPROD_RC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/ET_VTOGPROD_RC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/EXCHG_PFHT_RET-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/EXCHG_PFHT_RET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCMB/APO_BAPI_OBJDATA-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/APO_BAPI_OBJDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCWM/S_LOGREP_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCWM/S_LOGREP_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SEHS/BAS_EXTERRORGUID-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SEHS/BAS_EXTERRORGUID table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SEHS/BAS_LOGPARAMBAPI-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SEHS/BAS_LOGPARAMBAPI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_EXCLUSION_TRACE_S-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_EXCLUSION_TRACE_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_EXCLUSION_TRACE_S-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_EXCLUSION_TRACE_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_LEAD_APPL_LOG_RET-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_LEAD_APPL_LOG_RET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DCS_SEND_REQUEST_TYPE1-SYSTEM table field - The system Id of the source system. This field
▼
Description: The system Id of the source system. This field Field Name: SYSTEM Data Element: DCS_SYSTEM_TYPE Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DCS_SEND_REQUEST_TYPE1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ECATT_CAT_PINGRESPONSE-SYSTEM table field - Proxy Data Element (Generated)
▼
Description: Proxy Data Element (Generated) Field Name: SYSTEM Data Element: ECATT_CHAR3 Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ECATT_CAT_PINGRESPONSE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCS_COMPL_CONTAINER-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCS_COMPL_CONTAINER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESEESCS_PHRASE_MAPPING-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESEESCS_PHRASE_MAPPING table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_CNT_PS_NAV_EVENT-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_CNT_PS_NAV_EVENT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_CNT_PS_NAV_EVENT-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_CNT_PS_NAV_EVENT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_IF_INA_CONNECTOR-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_IF_INA_CONNECTOR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKDPR_S_GPART_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKDPR_S_GPART_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFM_CCF_CHAIN_MESSAGES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFM_CCF_CHAIN_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPM_BAPIRET_WITH_INDEX-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPM_BAPIRET_WITH_INDEX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LSO_BAPIRET2_SCH_DEP_C-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LSO_BAPIRET2_SCH_DEP_C table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RMSAS_API_VAI_EXTERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RMSAS_API_VAI_EXTERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SCMG_ATTR_RETURN_VALUE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCMG_ATTR_RETURN_VALUE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SHARED_XX_LOG_MESSAGES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SHARED_XX_LOG_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SMT_WD_S_TARGET_SYSTEM-SYSTEM table field - Transport Target of Request
▼
Description: Transport Target of Request Field Name: SYSTEM Data Element: TR_TARGET Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: TR_TARGET MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SMT_WD_S_TARGET_SYSTEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_SF_IS_PP_AD_EMAIL-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_SF_IS_PP_AD_EMAIL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_SF_IS_PP_INTORDER-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_SF_IS_PP_INTORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_ST_IS_PP_INTORDER-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_ST_IS_PP_INTORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_S_IS_PP_GLJOURLIN-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_S_IS_PP_GLJOURLIN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_S_IS_PP_VEND_ADRS-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_S_IS_PP_VEND_ADRS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WSTI_CALC_RESPONSE_STY-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WSTI_CALC_RESPONSE_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WSTI_INV_DOC_CREATE_IF-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WSTI_INV_DOC_CREATE_IF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ACCGO/MP_S_FEE_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ACCGO/MP_S_FEE_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_ACCCCDET-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_ACCCCDET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_AD_EMAIL-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_AD_EMAIL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CCTRSTDH-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CCTRSTDH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CCTRTIME-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CCTRTIME table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_COADJPST-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_COADJPST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_COMPCODE-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_COMPCODE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CURRENCY-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CURRENCY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CUST_BNK-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CUST_BNK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_FUNCAREA-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_FUNCAREA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_INTORDER-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_INTORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_PCTRSTDH-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_PCTRSTDH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_PCTRTIME-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_PCTRTIME table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_VEND_BNK-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_VEND_BNK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_CCTRSTDH-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_CCTRSTDH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_COMPCODE-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_COMPCODE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_CURRENCY-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_CURRENCY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_FUNCAREA-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_FUNCAREA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_INTORDER-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_INTORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_PCTRSTDH-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_PCTRSTDH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_ACPLTYP_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_ACPLTYP_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_AD_EMA_CU-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_AD_EMA_CU table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_AD_FAX_CU-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_AD_FAX_CU table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_AD_TEL_CU-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_AD_TEL_CU table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_BNK_ACT_C-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_BNK_ACT_C table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CCTRBAR_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CCTRBAR_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CCTRCGY_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CCTRCGY_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CCTRRPU_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CCTRRPU_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CCTRRTX_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CCTRRTX_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CELECAT_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CELECAT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CELEMTIME-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CELEMTIME table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CELEORD_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CELEORD_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CUSTCNT_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CUSTCNT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CUSTREG_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CUSTREG_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_CUST_ADRS-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_CUST_ADRS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_GLDACTP_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_GLDACTP_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_GLDDTYP_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_GLDDTYP_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_GLJOURDOC-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_GLJOURDOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_GLJOURLIN-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_GLJOURLIN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_IOBUSAR_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_IOBUSAR_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_IOCHUSR_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_IOCHUSR_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_IOITPCT_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_IOITPCT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_IOKALSM_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_IOKALSM_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_IOOHKEY_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_IOOHKEY_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_IOPLANT_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_IOPLANT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_IORAKEY_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_IORAKEY_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_IOSALOD_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_IOSALOD_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_IOTAXJR_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_IOTAXJR_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_ORDERTYPE-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_ORDERTYPE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_PCTRRES_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_PCTRRES_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_PCTRRTX_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_PCTRRTX_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_PCTRSEG_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_PCTRSEG_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_VENDCNT_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_VENDCNT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_VENDREG_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_VENDREG_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_S_IS_PP_VEND_ADRS-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_S_IS_PP_VEND_ADRS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/BAPI_PPC_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/BAPI_PPC_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/BAPI_RETURN_STR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/BAPI_RETURN_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/EXCHG_CATPRT_RC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/EXCHG_CATPRT_RC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/EXCHG_LOCPRT_RC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/EXCHG_LOCPRT_RC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/EXCHG_MATPRT_RC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/EXCHG_MATPRT_RC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/LOC_TR_RETURN_S-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/LOC_TR_RETURN_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCWM/S_QDEFECT_FUP_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCWM/S_QDEFECT_FUP_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMFDOR_S_ORDERSTATELOG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMFDOR_S_ORDERSTATELOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNVMBTCRRETURNSTRUCTURE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNVMBTCRRETURNSTRUCTURE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNVT_CONVERSION_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNVT_CONVERSION_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNV_BASIS_GENER_CONTEXT-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: CNV_BASIS_GENER_CTX_SYSTEM Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNV_BASIS_GENER_CONTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRM_WECTI_ISALES_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRM_WECTI_ISALES_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CTS_CONFIG_WD_ST_STATUS-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTS_CONFIG_WD_ST_STATUS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DTINF_S_GALILEI_MAPPING-SYSTEM table field - System installation ID
▼
Description: System installation ID Field Name: SYSTEM Data Element: DTINF_INSTID Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: CHAR10 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DTINF_S_GALILEI_MAPPING table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHFND_FS4MIG_S_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHFND_FS4MIG_S_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_BAPIRET2_EXTENDED-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_BAPIRET2_EXTENDED table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_IF_INA_SEARCH_LOG-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_IF_INA_SEARCH_LOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FARR_S_DPP_CUST_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FARR_S_DPP_CUST_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FARR_S_DPP_PART_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FARR_S_DPP_PART_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FREE_GOODS_010_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FREE_GOODS_010_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FSBP_MSG_SENDER_TECH_ID-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FSBP_MSG_SENDER_TECH_ID table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
HRFPM_S_FIN_CHK_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRFPM_S_FIN_CHK_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICLX_MESSAGE_PROTOCOL_S-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: ICLX_MESSAGE_SYSTEM_D Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICLX_MESSAGE_PROTOCOL_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MICE_DISPLAY_APPL_ERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MICE_DISPLAY_APPL_ERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_CAT_RT_REQ_SEARCH-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CAT_RT_REQ_SEARCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_EXT_PR_S_MESSAGES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_EXT_PR_S_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OSPWDELETE_EMAIL_IN_DOC-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OSPWDELETE_EMAIL_IN_DOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_SF_IS_PP_GLJOURDOC-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_SF_IS_PP_GLJOURDOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_SF_IS_PP_GLJOURLIN-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_SF_IS_PP_GLJOURLIN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_SF_IS_PP_VEND_ADRS-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_SF_IS_PP_VEND_ADRS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UISS_STF_IS_PP_INTORDER-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UISS_STF_IS_PP_INTORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WSAM_SHMAE_UI_INTERFACE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WSAM_SHMAE_UI_INTERFACE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WSRS_WD_FOA_OBN_CONTROL-SYSTEM table field - OBN System
▼
Description: OBN System Field Name: SYSTEM Data Element: WSRS_WD_FOA_SYSTEM Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WSRS_WD_FOA_OBN_CONTROL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_ACPLTYP_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_ACPLTYP_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_AD_EMA_CU-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_AD_EMA_CU table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_AD_FAX_CU-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_AD_FAX_CU table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_AD_TEL_CU-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_AD_TEL_CU table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_BNK_ACT_C-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_BNK_ACT_C table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CCTRBAR_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CCTRBAR_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CCTRCGY_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CCTRCGY_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CCTRRPU_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CCTRRPU_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CCTRRTX_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CCTRRTX_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CELECAT_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CELECAT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CELEMTIME-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CELEMTIME table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CELEORD_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CELEORD_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CUSTCNT_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CUSTCNT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CUSTREG_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CUSTREG_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_CUST_ADRS-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_CUST_ADRS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_GLDACTP_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_GLDACTP_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_GLDDTYP_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_GLDDTYP_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_GLJOURDOC-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_GLJOURDOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_GLJOURLIN-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_GLJOURLIN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_IOBUSAR_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_IOBUSAR_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_IOCHUSR_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_IOCHUSR_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_IOITPCT_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_IOITPCT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_IOKALSM_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_IOKALSM_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_IOOHKEY_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_IOOHKEY_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_IOPLANT_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_IOPLANT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_IORAKEY_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_IORAKEY_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_IOSALOD_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_IOSALOD_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_IOTAXJR_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_IOTAXJR_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_ORDERTYPE-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_ORDERTYPE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_PCTRRES_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_PCTRRES_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_PCTRRTX_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_PCTRRTX_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_PCTRSEG_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_PCTRSEG_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_VENDCNT_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_VENDCNT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_VENDREG_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_VENDREG_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_SF_IS_PP_VEND_ADRS-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_SF_IS_PP_VEND_ADRS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_CCTRSTDH-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_CCTRSTDH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_COMPCODE-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_COMPCODE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_CURRENCY-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_CURRENCY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_FUNCAREA-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_FUNCAREA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_INTORDER-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_INTORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_PCTRSTDH-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_PCTRSTDH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_CCTRBAR_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_CCTRBAR_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_CCTRRPU_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_CCTRRPU_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_CCTRRTX_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_CCTRRTX_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_CELECAT_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_CELECAT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_CELEORD_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_CELEORD_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_CUSTCNT_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_CUSTCNT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_CUSTREG_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_CUSTREG_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_GLDACTP_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_GLDACTP_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_GLDDTYP_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_GLDDTYP_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_IOBUSAR_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_IOBUSAR_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_IOCHUSR_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_IOCHUSR_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_IOITPCT_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_IOITPCT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_IOKALSM_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_IOKALSM_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_IOOHKEY_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_IOOHKEY_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_IOPLANT_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_IOPLANT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_IORAKEY_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_IORAKEY_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_IOSALOD_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_IOSALOD_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_IOTAXJR_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_IOTAXJR_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_ORDERTYPE-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_ORDERTYPE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_PCTRRES_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_PCTRRES_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_PCTRRTX_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_PCTRRTX_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_ST_IS_PP_PCTRSEG_A-SYSTEM table field - Logical system
▼
Description: Logical system Field Name: SYSTEM Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_ST_IS_PP_PCTRSEG_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/CURTO_GEN_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/CURTO_GEN_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/EXCHG_LOCPRTT_RC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/EXCHG_LOCPRTT_RC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/LOC_ATP_RETURN_S-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/LOC_ATP_RETURN_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/LOC_BADI_OUT_STR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/LOC_BADI_OUT_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCMTMS/S_EHS_DG_CHKFMSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMTMS/S_EHS_DG_CHKFMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCWM/S_BIF_AIN_BAPIRET2-SYSTEM table field - Proxy Data Element (Generated)
▼
Description: Proxy Data Element (Generated) Field Name: SYSTEM Data Element: /SCWM/DE_BIF_AIN_CHAR10 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCWM/S_BIF_AIN_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SDF/TEAP_STMS_TP_CRITAB-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: TMSCSYS Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SDF/TEAP_STMS_TP_CRITAB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIAPORETURNRECEIVECALL-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIAPORETURNRECEIVECALL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BTP_SMI_S_LOGCOMP_SYSTEM-SYSTEM table field - BTP SMSY System Name
▼
Description: BTP SMSY System Name Field Name: SYSTEM Data Element: BTP_SMI_SMSY_SYSTEMNAME Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: BTP_SMI_SMSY_SYSTEMNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BTP_SMI_S_LOGCOMP_SYSTEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BTP_SMI_S_PRODUCTVERSION-SYSTEM table field - BTP SMSY System Name
▼
Description: BTP SMSY System Name Field Name: SYSTEM Data Element: BTP_SMI_SMSY_SYSTEMNAME Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: BTP_SMI_SMSY_SYSTEMNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BTP_SMI_S_PRODUCTVERSION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BTP_SMI_S_SYSTEM_SYSROLE-SYSTEM table field - BTP SMSY System Name
▼
Description: BTP SMSY System Name Field Name: SYSTEM Data Element: BTP_SMI_SMSY_SYSTEMNAME Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: BTP_SMI_SMSY_SYSTEMNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BTP_SMI_S_SYSTEM_SYSROLE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CIF_CURTO_RTO_RETURN_EXT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CIF_CURTO_RTO_RETURN_EXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMT_IST_ATTRIBUTE_ERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMT_IST_ATTRIBUTE_ERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DCS_SEND_REQUEST_REQUEST-SYSTEM table field - The system Id of the source system. This field
▼
Description: The system Id of the source system. This field Field Name: SYSTEM Data Element: DCS_SYSTEM_TYPE Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DCS_SEND_REQUEST_REQUEST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESA_PA_EXTENDED_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESA_PA_EXTENDED_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_CNT_PS_INTENT_SPEC-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_CNT_PS_INTENT_SPEC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_IF_INA_RESP_SEARCH-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_IF_INA_RESP_SEARCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_IF_OBJECT_FEEDBACK-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_IF_OBJECT_FEEDBACK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_MU_ASSIST_IMP_TEXT-SYSTEM table field - Text, Length 30
▼
Description: Text, Length 30 Field Name: SYSTEM Data Element: ESH_E_MU_TEXT30 Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: ESH_D_MU_TEXT30 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_MU_ASSIST_IMP_TEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_MU_ASSIST_IMP_TEXT-SYSTEM table field - Text, Length 30
▼
Description: Text, Length 30 Field Name: SYSTEM Data Element: ESH_E_MU_TEXT30 Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: ESH_D_MU_TEXT30 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_MU_ASSIST_IMP_TEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_MU_ASSIST_IMP_TEXT-SYSTEM table field - Text, Length 30
▼
Description: Text, Length 30 Field Name: SYSTEM Data Element: ESH_E_MU_TEXT30 Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: ESH_D_MU_TEXT30 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_MU_ASSIST_IMP_TEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKC_DOCUMENT_CANCEL_CONF-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKC_DOCUMENT_CANCEL_CONF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKC_DOCUMENT_CREATE_CONF-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKC_DOCUMENT_CREATE_CONF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMIL_RETURN_MESSSAGE_STY-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMIL_RETURN_MESSSAGE_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LSO_BAPIRET2_SCH_INDEP_C-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LSO_BAPIRET2_SCH_INDEP_C table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LSO_BOOKING_CHECK_RESULT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LSO_BOOKING_CHECK_RESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MDSUBSTN_S_VALDTN_RESULT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDSUBSTN_S_VALDTN_RESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
POC_FAC_S_SCOPE_OBJ_INST-SYSTEM table field - Process Facade : System Identifier
▼
Description: Process Facade : System Identifier Field Name: SYSTEM Data Element: POC_FAC_SYSTEM Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POC_FAC_S_SCOPE_OBJ_INST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WSTI_CALC_SEL_SCREEN_STY-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WSTI_CALC_SEL_SCREEN_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/AIF/S_ALERT_CPWF_CONTEXT-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /AIF/S_ALERT_CPWF_CONTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/IWNGW/S_HUB_CACHE_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /IWNGW/S_HUB_CACHE_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_CCTRBAR_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_CCTRBAR_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_CCTRRPU_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_CCTRRPU_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_CCTRRTX_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_CCTRRTX_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_CELECAT_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_CELECAT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_CELEORD_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_CELEORD_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_CUSTCNT_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_CUSTCNT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_CUSTREG_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_CUSTREG_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_GLDACTP_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_GLDACTP_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_GLDDTYP_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_GLDDTYP_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_IOBUSAR_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_IOBUSAR_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_IOCHUSR_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_IOCHUSR_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_IOITPCT_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_IOITPCT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_IOKALSM_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_IOKALSM_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_IOOHKEY_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_IOOHKEY_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_IOPLANT_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_IOPLANT_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_IORAKEY_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_IORAKEY_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_IOSALOD_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_IOSALOD_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_IOTAXJR_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_IOTAXJR_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_ORDERTYPE-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_ORDERTYPE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_PCTRRES_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_PCTRRES_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_PCTRRTX_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_PCTRRTX_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MDG/_STF_IS_PP_PCTRSEG_A-SYSTEM table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEM Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MDG/_STF_IS_PP_PCTRSEG_A table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/EXCHG_CATPRTXT_RC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/EXCHG_CATPRTXT_RC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/EXCHG_MATPRMRM_RC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/EXCHG_MATPRMRM_RC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/EXCHG_MATPRTXT_RC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/EXCHG_MATPRTXT_RC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/LOC_CHECK_LOC_STR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/LOC_CHECK_LOC_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCMB/DATARC_PRTPTERM_STR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/DATARC_PRTPTERM_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCMTMS/S_TOR_ITEM_PKG_ID-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMTMS/S_TOR_ITEM_PKG_ID table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SDF/ZQLMDATASELECTFILTER-SYSTEM table field - Y -System
▼
Description: Y -System Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SDF/ZQLMDATASELECTFILTER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/TMF/MESSAGE_RETURN_TABLE-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /TMF/MESSAGE_RETURN_TABLE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CACS_S_SCTR_CHK_CL_MSG_WD-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACS_S_SCTR_CHK_CL_MSG_WD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMM_S_ROBJ_PRC_ANALYS_LOG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_ROBJ_PRC_ANALYS_LOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRM_DWP_CHECK_RESULT_LINE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRM_DWP_CHECK_RESULT_LINE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRM_LRP_CHECK_RESULT_LINE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRM_LRP_CHECK_RESULT_LINE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DMEE_SYNC_TREE_ITEM_STRUC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DMEE_SYNC_TREE_ITEM_STRUC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESA_TIM_EXTENDED_BAPIRET2-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESA_TIM_EXTENDED_BAPIRET2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_IF_INA_SUGGEST_CONN-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_IF_INA_SUGGEST_CONN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAC_ACC_DET_S_STD_ACC_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_ACC_DET_S_STD_ACC_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FIN_CSPC_S_REQUEST_RESULT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FIN_CSPC_S_REQUEST_RESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FSBP_PRX_MESSAGE_ENHANCED-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FSBP_PRX_MESSAGE_ENHANCED table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FSH_S_ALV_RETURN_MRP_DATA-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FSH_S_ALV_RETURN_MRP_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OSPWDELETE_CONTACT_IN_DOC-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OSPWDELETE_CONTACT_IN_DOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OSPWMAINTAIN_EMAIL_IN_DOC-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OSPWMAINTAIN_EMAIL_IN_DOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SCWB_PUSH_S_DISP_RES_DARK-SYSTEM table field - Character Field with Length 10
▼
Description: Character Field with Length 10 Field Name: SYSTEM Data Element: CHAR10 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: CHAR10 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCWB_PUSH_S_DISP_RES_DARK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDIDELETE_DISYSTEM_IN_DOC-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: TDIWSTMSSYSTEM Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDIDELETE_DISYSTEM_IN_DOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDIMODIFY_DISYSTEM_IN_DOC-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: TDIWSTMSSYSTEM Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDIMODIFY_DISYSTEM_IN_DOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WSRS_WD_FOA_SERVER_ACTION-SYSTEM table field - OBN System
▼
Description: OBN System Field Name: SYSTEM Data Element: WSRS_WD_FOA_SYSTEM Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WSRS_WD_FOA_SERVER_ACTION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/BA1/F4_STR_INTRATES_W_ERR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /BA1/F4_STR_INTRATES_W_ERR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/IWBEP/S_MESSAGE_CONTAINER-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /IWBEP/S_MESSAGE_CONTAINER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/IWWRK/S_MESSAGE_CONTAINER-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /IWWRK/S_MESSAGE_CONTAINER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/LOC_MODEL_RETURN_S-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/LOC_MODEL_RETURN_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/LOC_SITEM_RETURN_S-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/LOC_SITEM_RETURN_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/LOC_TPSRC_RETURN_S-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/LOC_TPSRC_RETURN_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCMB/DATARC_PRTPTERMT_STR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/DATARC_PRTPTERMT_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCMB/DATARC_PRTPURDOC_STR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/DATARC_PRTPURDOC_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SEHS/BAS_EXTERROR_WA_TYPE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SEHS/BAS_EXTERROR_WA_TYPE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CACS_S_SCTR_AGRTCHK_MSG_WD-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACS_S_SCTR_AGRTCHK_MSG_WD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CACS_S_SCTR_AGR_CHK_MSG_WD-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACS_S_SCTR_AGR_CHK_MSG_WD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DPR_R3DMS_TS_FREE_TEXT_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DPR_R3DMS_TS_FREE_TEXT_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DTINF_S_SYS_TC_TABLE_GUIDS-SYSTEM table field - XML String
▼
Description: XML String Field Name: SYSTEM Data Element: DTINF_XML_STRING Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: STRING MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DTINF_S_SYS_TC_TABLE_GUIDS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCS_SPEC_COMPL_COMPLETE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCS_SPEC_COMPL_COMPLETE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCS_SPEC_COMPL_COMPLETE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCS_SPEC_COMPL_COMPLETE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_IF_INA_MD_REQ_SEARCH-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_IF_INA_MD_REQ_SEARCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_IF_INA_RESP_METADATA-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_IF_INA_RESP_METADATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_IF_INA_RT_REQ_SEARCH-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_IF_INA_RT_REQ_SEARCH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_MU_ASSIST_POPUP_TEXT-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: ESH_S_MU_ASSIST_VH_SYSTEM Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_MU_ASSIST_POPUP_TEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FAA_ES_S_MD_BAPIRET2_KEYED-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAA_ES_S_MD_BAPIRET2_KEYED table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FARR_S_INB_SRCDOC_ITEM_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FARR_S_INB_SRCDOC_ITEM_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICLX_MESSAGE_PROTOCOL_S_IN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICLX_MESSAGE_PROTOCOL_S_IN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LOC_SUBSTN_S_VALDTN_RESULT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LOC_SUBSTN_S_VALDTN_RESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPTIMEDEPDNT_STKLVL_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPTIMEDEPDNT_STKLVL_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PROD_SUBSTN_EXCLN_S_RESULT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PROD_SUBSTN_EXCLN_S_RESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WSRS_WD_FOA_OBN_PARAMETERS-SYSTEM table field - OBN System
▼
Description: OBN System Field Name: SYSTEM Data Element: WSRS_WD_FOA_SYSTEM Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WSRS_WD_FOA_OBN_PARAMETERS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ACCGO/CAS_S_NS_STL_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ACCGO/CAS_S_NS_STL_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/DMBE/SI_QS_UPDATE_MESSAGES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/SI_QS_UPDATE_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/PLMB/S_EDESK_TITLEBLOCK_SP-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMB/S_EDESK_TITLEBLOCK_SP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/LOC_MATRIX_RETURN_S-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/LOC_MATRIX_RETURN_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/LOC_SGROUP_RETURN_S-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/LOC_SGROUP_RETURN_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPSLL/LCLIC_RET_MESSAGE_S-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPSLL/LCLIC_RET_MESSAGE_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCMB/DATARC_PRTPARTNER_STR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/DATARC_PRTPARTNER_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCMB/DATARC_PRTPURDOCH_STR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/DATARC_PRTPURDOCH_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCMB/PRODSUB_S_VALD_RESULT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/PRODSUB_S_VALD_RESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SDF/DISP_TIMES_WITH_PERIOD-SYSTEM table field - SAP System ID
▼
Description: SAP System ID Field Name: SYSTEM Data Element: BDLSYSID Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: CHAR3 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SDF/DISP_TIMES_WITH_PERIOD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BBS_ER_RESULT_FROM_TRANSFER-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BBS_ER_RESULT_FROM_TRANSFER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EHPRCS_SPEC_COMPL_CONTAINER-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCS_SPEC_COMPL_CONTAINER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_MU_ASSIST_IMP_DB_TEXT-SYSTEM table field - Text, Length 30
▼
Description: Text, Length 30 Field Name: SYSTEM Data Element: ESH_E_MU_TEXT30 Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: ESH_D_MU_TEXT30 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_MU_ASSIST_IMP_DB_TEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_MU_ASSIST_IMP_DS_TEXT-SYSTEM table field - Text, Length 30
▼
Description: Text, Length 30 Field Name: SYSTEM Data Element: ESH_E_MU_TEXT30 Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: ESH_D_MU_TEXT30 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_MU_ASSIST_IMP_DS_TEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_PLAN_MESSAGE_DATAPAKID-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_PLAN_MESSAGE_DATAPAKID table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FIN_CFIN_S_CSPC_CPAY_RESULT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FIN_CFIN_S_CSPC_CPAY_RESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FVD_BACP_I_LDR_IN_CR_BK_WEL-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FVD_BACP_I_LDR_IN_CR_BK_WEL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
HRFPM_S_FIN_CHK_MSG_BAPIRET-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRFPM_S_FIN_CHK_MSG_BAPIRET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OSPWMAINTAIN_CONTACT_IN_DOC-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OSPWMAINTAIN_CONTACT_IN_DOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PLANT_SUBSTN_EXCLN_S_RESULT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLANT_SUBSTN_EXCLN_S_RESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PROD_SUBSTN_SUBSTN_S_RESULT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PROD_SUBSTN_SUBSTN_S_RESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PROD_SUBSTN_S_VALDTN_RESULT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PROD_SUBSTN_S_VALDTN_RESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SCTS_TY_CLOUD_LOG_COMPONENT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCTS_TY_CLOUD_LOG_COMPONENT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ISDFPS/S_PE_UPDATE_LOG_BAPI-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/S_PE_UPDATE_LOG_BAPI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/CIF_CURTO_RTO_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/CIF_CURTO_RTO_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/DATARC_PRTPURGRP_STR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/DATARC_PRTPURGRP_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/LOC_MATLOCS_RETURN_S-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/LOC_MATLOCS_RETURN_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/LOC_RESHEAD_RETURN_S-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/LOC_RESHEAD_RETURN_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/LOC_TRMCARR_RETURN_S-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/LOC_TRMCARR_RETURN_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
APB_LPD_S_NAVIGATE_TO_OBJECT-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APB_LPD_S_NAVIGATE_TO_OBJECT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CACS_S_STDCTR_CHK_CL_MSG_VAC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACS_S_STDCTR_CHK_CL_MSG_VAC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNV_PE_S_ULV_BAPIMSG_CONTEXT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNV_PE_S_ULV_BAPIMSG_CONTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EEDM_PROFILE_UPLOAD_LOG_DATA-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EEDM_PROFILE_UPLOAD_LOG_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
HRPAYRU_IC_SEND_REQUEST_TYPE-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRPAYRU_IC_SEND_REQUEST_TYPE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_REQ_BE_EOP_DELETE_SYNC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_REQ_BE_EOP_DELETE_SYNC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OSPWDELETE_CALENDAR_EVENT_IN-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OSPWDELETE_CALENDAR_EVENT_IN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PLANT_SUBSTN_SUBSTN_S_RESULT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLANT_SUBSTN_SUBSTN_S_RESULT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPMGAG_S_DASHBOARD_ERROR_MSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPMGAG_S_DASHBOARD_ERROR_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPMGAG_S_PPA_FILE_ATTACH_RES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPMGAG_S_PPA_FILE_ATTACH_RES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SPFL_PARAMETER_ERROR_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SPFL_PARAMETER_ERROR_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SQLMDATASELECTFILTERSTMTKIND-SYSTEM table field - Y -System
▼
Description: Y -System Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SQLMDATASELECTFILTERSTMTKIND table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TFENDP_ADD_CUSTOMER_RESPONSE-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: CHAR108 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TFENDP_ADD_CUSTOMER_RESPONSE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ACCGO/CMN_S_CTR_ITEM_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ACCGO/CMN_S_CTR_ITEM_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ACCGO/CMN_S_SIMUL_DPQS_ERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ACCGO/CMN_S_SIMUL_DPQS_ERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/IPRO/S_RET_LIST_DOCB_ARCHIVE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /IPRO/S_RET_LIST_DOCB_ARCHIVE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/LTB/TR_S_ULV_BAPIMSG_CONTEXT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /LTB/TR_S_ULV_BAPIMSG_CONTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/OSP/DELETE_CALENDAR_EVENT_IN-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /OSP/DELETE_CALENDAR_EVENT_IN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/CIF_CURTO_RTO_RET_EXT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/CIF_CURTO_RTO_RET_EXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/DATARC_PRTPURGRPT_STR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/DATARC_PRTPURGRPT_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/LOC_HIERARCH_RETURN_S-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/LOC_HIERARCH_RETURN_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/MSDP_DEP_MESSAGES_STR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/MSDP_DEP_MESSAGES_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/TMF/MESSAGE_RETURN_TABLE_EFD-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /TMF/MESSAGE_RETURN_TABLE_EFD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/TMF/NFCREATION_RETURN_RETURN-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /TMF/NFCREATION_RETURN_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ACMDT_S_OBJSTATMON_REPAIRITEM-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACMDT_S_OBJSTATMON_REPAIRITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BCA_STR_DIM_CLR_FROM_CR_ERMSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BCA_STR_DIM_CLR_FROM_CR_ERMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CACS_S_STDCTR_AGRTCHK_MSG_VAC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACS_S_STDCTR_AGRTCHK_MSG_VAC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CACS_S_STDCTR_AGR_CHK_MSG_VAC-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACS_S_STDCTR_AGR_CHK_MSG_VAC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNDS_COND_MIG_MESSAGE_CONTEXT-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNDS_COND_MIG_MESSAGE_CONTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
COD_UTILITIES_S_SWITCHDOC_LOG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COD_UTILITIES_S_SWITCHDOC_LOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFPS_S_MPOINT_NO_CHG_AUTH_ERR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFPS_S_MPOINT_NO_CHG_AUTH_ERR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ECRM_ISU_BAPI_EXTENTED_RETURN-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ECRM_ISU_BAPI_EXTENTED_RETURN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_CNT_PS_INTENT_SPEC_FLAT-SYSTEM table field - ABAP System Field: Name of SAP System
▼
Description: ABAP System Field: Name of SAP System Field Name: SYSTEM Data Element: SYST_SYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_CNT_PS_INTENT_SPEC_FLAT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_MU_ASSIST_IMP_AUTH_TEXT-SYSTEM table field - Text, Length 30
▼
Description: Text, Length 30 Field Name: SYSTEM Data Element: ESH_E_MU_TEXT30 Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: ESH_D_MU_TEXT30 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_MU_ASSIST_IMP_AUTH_TEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FDC_S_ACCDOC_WARNING_MESSAGES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FDC_S_ACCDOC_WARNING_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
HRPAYRU_IC_SEND_REQUEST_TYPE1-SYSTEM table field - The system Id of the source system. This field
▼
Description: The system Id of the source system. This field Field Name: SYSTEM Data Element: HRPAYRU_IC_SYSTEM_TYPE Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRPAYRU_IC_SEND_REQUEST_TYPE1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OSPWDELETE_ACTION_ITEM_IN_DOC-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OSPWDELETE_ACTION_ITEM_IN_DOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPMGAG_S_PPA_DEL_FILE_REQ_RES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPMGAG_S_PPA_DEL_FILE_REQ_RES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SIM_PFCG_ORGFIELD_UPGRADE_ALV-SYSTEM table field - Name of SAP System
▼
Description: Name of SAP System Field Name: SYSTEM Data Element: SYSYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SIM_PFCG_ORGFIELD_UPGRADE_ALV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ACCGO/CMN_S_OBLIGATION_ERRORS-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ACCGO/CMN_S_OBLIGATION_ERRORS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ACCGO/CMN_S_OPTIONALITY_ERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ACCGO/CMN_S_OPTIONALITY_ERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ACCGO/CMN_S_PRICING_LOT_ERROR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ACCGO/CMN_S_PRICING_LOT_ERROR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/BA1/F4_FX_STRUC_NEW_RATES_PCL-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /BA1/F4_FX_STRUC_NEW_RATES_PCL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/DMBE/SI_CONTRACT_LOCK_MESSAGE-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/SI_CONTRACT_LOCK_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/IPRO/PSSRM_DOCUMENT_DOCB_ATTA-SYSTEM table field - Proxy Data Element (Generated)
▼
Description: Proxy Data Element (Generated) Field Name: SYSTEM Data Element: /IPRO/CHAR10 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /IPRO/PSSRM_DOCUMENT_DOCB_ATTA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/IWFND/S_MGW_MESSAGE_CONTAINER-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /IWFND/S_MGW_MESSAGE_CONTAINER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/OSP/MAINTAIN_CALENDAR_EVENT_I-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /OSP/MAINTAIN_CALENDAR_EVENT_I table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPAPO/PUIA_DRP_EDITCNTRL_STR-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/PUIA_DRP_EDITCNTRL_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPWF/BAPIRET2_FIX_________00-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPWF/BAPIRET2_FIX_________00 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPWF/BAPIRET2_____________00-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPWF/BAPIRET2_____________00 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPWF/BAPI_VBKA_BINRELSHIP_00-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPWF/BAPI_VBKA_BINRELSHIP_00 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPWF/BAPI_VBKA_BOIDREF____00-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPWF/BAPI_VBKA_BOIDREF____00 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPWF/MATRETURN2___________00-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPWF/MATRETURN2___________00 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPWF/WFSYST_______________00-SYSTEM table field - System
▼
Description: System Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPWF/WFSYST_______________00 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SDF/ZQLMDATASELFILTERSTMTKIND-SYSTEM table field - Y -System
▼
Description: Y -System Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SDF/ZQLMDATASELFILTERSTMTKIND table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SHCM/ORIGINAL_SYSTEM_INFORMAT-SYSTEM table field - LANGUAGE INDEPENDENT LONG Name
▼
Description: LANGUAGE INDEPENDENT LONG Name Field Name: SYSTEM Data Element: /SHCM/SYSTEM_ID Data Type: CHAR length (Dec): 80(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SHCM/ORIGINAL_SYSTEM_INFORMAT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/TMF/FIPOSTING_RETURN_RETURN_T-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /TMF/FIPOSTING_RETURN_RETURN_T table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/TMF/NFCORRECTION_LETTER_RETU1-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /TMF/NFCORRECTION_LETTER_RETU1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_TF_ENDP_ADD_CUSTOMERRESPO-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: CHAR108 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_TF_ENDP_ADD_CUSTOMERRESPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_TF_ENDP_DEL_CUSTOMERRESPO-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: CHAR108 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_TF_ENDP_DEL_CUSTOMERRESPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BCA_STR_DIM_REF_REVERSAL_ERMSG-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BCA_STR_DIM_REF_REVERSAL_ERMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BCA_STR_INT_IN_BILL_CANCEL_PPO-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BCA_STR_INT_IN_BILL_CANCEL_PPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BCA_STR_INT_IN_BILL_CANCEL_PPO-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BCA_STR_INT_IN_BILL_CANCEL_PPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BUSINESS_PARTNER_RESPONSE_EOP1-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUSINESS_PARTNER_RESPONSE_EOP1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCMSBI_WAST_TEST_IP_SR_ROW_GVL-SYSTEM table field - Name of SAP System
▼
Description: Name of SAP System Field Name: SYSTEM Data Element: SYSYSID Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYCHAR08 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMSBI_WAST_TEST_IP_SR_ROW_GVL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ESH_S_ADM_CONSIST_CHECK_RES_UI-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_ADM_CONSIST_CHECK_RES_UI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FARRIC_S_SD_REFFIELDS_MESSAGES-SYSTEM table field - Logical system from which message originates
▼
Description: Logical system from which message originates Field Name: SYSTEM Data Element: BAPILOGSYS Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FARRIC_S_SD_REFFIELDS_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
HRPAYBRBRANCH_GETDETAIL_RESPON-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: HRPAYBRCHAR10 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRPAYBRBRANCH_GETDETAIL_RESPON table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
HRPAYNA_WS_REMIT_ADDENDA_RECRE-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: CHAR1039 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRPAYNA_WS_REMIT_ADDENDA_RECRE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
HRPAYRU_IC_SEND_REQUEST_REQUES-SYSTEM table field - The system Id of the source system. This field
▼
Description: The system Id of the source system. This field Field Name: SYSTEM Data Element: HRPAYRU_IC_SYSTEM_TYPE Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRPAYRU_IC_SEND_REQUEST_REQUES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
HRPP_WSBAPI_ACC_DOCUMENT_DISPL-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: PCPO_WSCHAR10 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HRPP_WSBAPI_ACC_DOCUMENT_DISPL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OSPWMAINTAIN_ACTION_ITEM_IN_DO-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OSPWMAINTAIN_ACTION_ITEM_IN_DO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OSPWMAINTAIN_CALENDAR_EVENT_IN-SYSTEM table field -
▼
Description: Field Name: SYSTEM Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OSPWMAINTAIN_CALENDAR_EVENT_IN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PING1ENDP_ADD_CUSTOMER_RESPONS-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: CHAR108 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PING1ENDP_ADD_CUSTOMER_RESPONS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PING1ENDP_DEL_CUSTOMER_RESPONS-SYSTEM table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: SYSTEM Data Element: CHAR108 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PING1ENDP_DEL_CUSTOMER_RESPONS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WS2_EXT_SDL_GET_SAP_SYSTEM_DE1-SYSTEM table field - Proxy Data Element (Generated)
▼
Description: Proxy Data Element (Generated) Field Name: SYSTEM Data Element: WS2_CHAR80 Data Type: CHAR length (Dec): 80(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WS2_EXT_SDL_GET_SAP_SYSTEM_DE1 table
|