SAP SYSTEMMESSAGENUMBER field - Message Number details in SAP

Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211

Details

IGRIRINF-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGRIRINF table

CDMVALMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMVALMSG table

CMFGGMETP-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: T100 Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMFGGMETP table

IGRIRPRED-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGRIRPRED table

IMFGGMETP-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: T100 Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGGMETP table

PCPEROUND-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPEROUND table

PCPETRATE-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPETRATE table

PJEAPILOG-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message Number ▼ Description: ABAP System Field: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PJEAPILOG table

CACMBPPNLQ-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMBPPNLQ table

CDMCITMMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMCITMMSG table

CDMVALMSGX-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMVALMSGX table

CDOCMSGDET-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDOCMSGDET table

CRSHOPRVAL-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRSHOPRVAL table

PCPEQQPAVG-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPEQQPAVG table

PCPEQQPSUM-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPEQQPSUM table

PCPETVALUE-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPETVALUE table

PJEAPILOGP-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PJEAPILOGP table

CPMUPDTMSGS-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPMUPDTMSGS table

IDRVTVMTMIL-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDRVTVMTMIL table

IMTMMESSAGE-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMTMMESSAGE table

PCMMUNIONPF-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMUNIONPF table

PCPEQPQGSUM-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPEQPQGSUM table

PCPEQQPQUOT-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPEQQPQUOT table

PDRVTVMTMAL-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDRVTVMTMAL table

PDRVTVMTMBL-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDRVTVMTMBL table

PPUBSECNOTE-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPUBSECNOTE table

PUNIONMTMPF-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PUNIONMTMPF table

CDMITMCATMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMITMCATMSG table

CDMVALMSGREC-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMVALMSGREC table

CDMVALMSGSUM-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMVALMSGSUM table

CJITAPPLAREA-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CJITAPPLAREA table

IJITAPPLAREA-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IJITAPPLAREA table

ILCMMESSAGES-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILCMMESSAGES table

PCMMPNLBPEXT-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLBPEXT table

PCMMPNLBPTOP-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLBPTOP table

PCMMPNLNAEXT-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLNAEXT table

PCPEQPQQGITM-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPEQPQQGITM table

PCPERATEDCUR-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPERATEDCUR table

PEVALRSLTSTL-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEVALRSLTSTL table

PPSBRFMSGIDN-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPSBRFMSGIDN table

CCTRLGOVHDMSG-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCTRLGOVHDMSG table

IACMBPPNLVALC-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMBPPNLVALC table

ICMDTYORDQERR-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMDTYORDQERR table

IDRVTVMTMCUBE-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDRVTVMTMCUBE table

IMRPMDISSCATA-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPMDISSCATA table

IPAYTPRPSLMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYTPRPSLMSG table

IPUBSECBRFMSG-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECBRFMSG table

IPUBSECNOTETP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECNOTETP table

PCMMPNLBPAGGR-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLBPAGGR table

PCMMPNLBPCALC-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLBPCALC table

PCMMPNLBPPREP-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLBPPREP table

PCMMPNLNAAGGR-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLNAAGGR table

PCMMPNLNACALC-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLNACALC table

PCMMPNLNAPREP-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLNAPREP table

PCPETRATESTOD-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPETRATESTOD table

PCPETVALSCURR-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPETVALSCURR table

PEVALMTMDODTL-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEVALMTMDODTL table

PPAYTPRPSLITM-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPAYTPRPSLITM table

PPAYTPRPSLMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPAYTPRPSLMSG table

CCMMBPPNLVALUE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMBPPNLVALUE table

CCMMNAPNLVALUE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMNAPNLVALUE table

CCOLPROCERRLOG-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOLPROCERRLOG table

CPUBSSECNOTETP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPUBSSECNOTETP table

CPURGDOCSIMLOG-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURGDOCSIMLOG table

IACMMTMMESSAGE-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMMTMMESSAGE table

IACMMTMVALCUBE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMMTMVALCUBE table

ICMMDTYMTMVALC-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMDTYMTMVALC table

ICMMUNIONPFEXT-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMUNIONPFEXT table

IDMCCLOGITMMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMCCLOGITMMSG table

IFIGRIRMONITOR-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGRIRMONITOR table

IPURGDOCSIMLOG-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURGDOCSIMLOG table

IRSHACTYLOGMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRSHACTYLOGMSG table

IRSHORDMESSAGE-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRSHORDMESSAGE table

IUNIONMTMPFEXT-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IUNIONMTMPFEXT table

PACMMTMVALCUBE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMVALCUBE table

PACMSTKDPQSVAL-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMSTKDPQSVAL table

PCMMPNLNACALC2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLNACALC2 table

PCMMPNLNACALC3-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLNACALC3 table

PCMMPNLNACALC4-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLNACALC4 table

PCPEQQPQGITCUR-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPEQQPQGITCUR table

PCPEQQPQGITUOM-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPEQQPQGITUOM table

PNETPOSFINUPDD-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNETPOSFINUPDD table

CCMMBPPNLVALUEQ-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMBPPNLVALUEQ table

CPUBSECBRFMSGTP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPUBSECBRFMSGTP table

IACMSTKQLTYCUBE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMSTKQLTYCUBE table

ICMDTYORDQERRRW-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMDTYORDQERRRW table

ICMMUNIONPFCUBE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMUNIONPFCUBE table

ICTRLGOVHDMSGTP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICTRLGOVHDMSGTP table

IPUBSECBRFMSGTP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECBRFMSGTP table

ISTKDPQSVALEXTN-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTKDPQSVALEXTN table

IUNIONMTMPFCUBE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IUNIONMTMPFCUBE table

PCMMDTYMTMVALID-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMDTYMTMVALID table

PCMMDTYMTMVALUE-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMDTYMTMVALUE table

PCMMPNLNAIMPREP-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLNAIMPREP table

PCPETVALUEROUND-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPETVALUEROUND table

PEVALRSLTSCURTL-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEVALRSLTSCURTL table

PNETPOSFINPREPD-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNETPOSFINPREPD table

CSETTLMNTACTMESG-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSETTLMNTACTMESG table

IACMBPPNLVALCUBE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMBPPNLVALCUBE table

IGMOVPHANTERRMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMOVPHANTERRMSG table

IRSHORDMESSAGEVH-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRSHORDMESSAGEVH table

ISETTLMNTACTMESG-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISETTLMNTACTMESG table

PCMMPNLNAIMAGGRG-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLNAIMAGGRG table

PCPEQPQQGITMQUOT-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPEQPQQGITMQUOT table

PNSFX1-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNSFX1 table

PNSFX2-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNSFX2 table

IVFINDIL-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVFINDIL table

PSNOTETP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSNOTETP table

PVFINDIL-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PVFINDIL table

CMDIMPORT-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDIMPORT table

CPPMGAPMS-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPPMGAPMS table

FIMSG_GFN-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FIMSG_GFN table

MESSA_GFN-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MESSA_GFN table

PCONTRMTM-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCONTRMTM table

PVLOGPRD2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PVLOGPRD2 table

ADISTRMSGS-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ADISTRMSGS table

CBDLIF0798-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBDLIF0798 table

CBDOCF0797-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBDOCF0797 table

CCAINV_CFC-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINV_CFC table

CDISTRMSGS-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDISTRMSGS table

CRFMOFAJMD-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMOFAJMD table

ICAINV_CFC-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINV_CFC table

IDISTRMSGS-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDISTRMSGS table

IMPEOBJLOG-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPEOBJLOG table

IVFINDCUBE-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVFINDCUBE table

MDC_IMPORT-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: * Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDC_IMPORT table

PPRCALCAGE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRCALCAGE table

PSBRFMSGTP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSBRFMSGTP table

ICAINVCFCTP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINVCFCTP table

IMDIMPORTTP-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMDIMPORTTP table

IMRPMDISSUE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPMDISSUE table

IPPMGAPMSTP-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMGAPMSTP table

IPRACCNOTIF-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCNOTIF table

PACMMTMVEXT-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMVEXT table

PCMDTVALFIN-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMDTVALFIN table

PCPETERMVAL-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPETERMVAL table

PDRVTVPOSIL-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDRVTVPOSIL table

PMPEOACHIST-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPEOACHIST table

PNSCALCVAL1-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNSCALCVAL1 table

PNSCALCVAL2-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNSCALCVAL2 table

CACMPNLNAVAL-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMPNLNAVAL table

CCRDTCTRLMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCRDTCTRLMSG table

CMPEEXECHIST-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPEEXECHIST table

CPRDTVACCMON-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRDTVACCMON table

CSIMLNSTSCNT-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSIMLNSTSCNT table

IACMPNLNAVLC-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMPNLNAVLC table

ICMMBPPNLVAL-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMBPPNLVAL table

ICRDTCTRLMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICRDTCTRLMSG table

IMPEEXECHIST-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPEEXECHIST table

IMTMSTOCKFIN-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMTMSTOCKFIN table

IPPMGAPPRMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMGAPPRMSG table

IRFMOFAJMDOC-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMOFAJMDOC table

ISRTAXITMLOG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRTAXITMLOG table

MESSA_KK_GFN-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MESSA_KK_GFN table

PACMCDMTMVAL-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMCDMTMVAL table

PCMMPNLBPCAL-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLBPCAL table

PCMMPNLBPSUM-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLBPSUM table

PCMMPNLNACAL-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLNACAL table

PCMMPNLNASUM-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLNASUM table

PCMMPNLNATOP-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLNATOP table

PCMMUNIONPF2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMUNIONPF2 table

PCPETERMVAL1-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPETERMVAL1 table

PCPETERMVAL2-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPETERMVAL2 table

PELEBASEDATA-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PELEBASEDATA table

PMTMSTOCKFIN-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMTMSTOCKFIN table

PNETBPPNLCMD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNETBPPNLCMD table

PNSTKUPDDATA-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNSTKUPDDATA table

PQUOTTIMESRS-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PQUOTTIMESRS table

PUNIONMTMPF2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PUNIONMTMPF2 table

PVLOGPQSQPD2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PVLOGPQSQPD2 table

PVLOGPRDADJ2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PVLOGPRDADJ2 table

CACMPNLDNAVAL-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMPNLDNAVAL table

CALLOCNRUNMSG-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CALLOCNRUNMSG table

CMM_S_QP_AGGR-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_QP_AGGR table

CMRPMDISSUETP-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMRPMDISSUETP table

CORDRCONFMSGS-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CORDRCONFMSGS table

CRCPFINDERISS-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRCPFINDERISS table

DFKKINV_CFC_D-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKINV_CFC_D table

FINS_GRIRPROC-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: * Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_GRIRPROC table

IACMBPNETPNLC-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMBPNETPNLC table

IACMPNLNADVAL-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMPNLNADVAL table

IALLOCNRUNMSG-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IALLOCNRUNMSG table

ICMMBPPNLVALC-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMBPPNLVALC table

ICMMPOSVALCNV-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMPOSVALCNV table

ICNSLDINPTMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNSLDINPTMSG table

ICNSLDPROCMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNSLDPROCMSG table

IDMCCLOGMCMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMCCLOGMCMSG table

IFINOCSTAGING-SYSTEMMESSAGENUMBER table field - 3-Byte field ▼ Description: 3-Byte field Field Name: SYSTEMMESSAGENUMBER Data Element: CHAR3 Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: CHAR3 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFINOCSTAGING table

IMRPMDISSUETP-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPMDISSUETP table

IMTMNETSTKFIN-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMTMNETSTKFIN table

IORDRCONFMSGS-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IORDRCONFMSGS table

IPAYTPRPSLITM-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYTPRPSLITM table

IPAYTREQNHIST-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYTREQNHIST table

ISTOCKMTMFINC-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTOCKMTMFINC table

MPEGMETPDRAFT-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPEGMETPDRAFT table

PACMPNLNADFIN-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMPNLNADFIN table

PACMPNLNADPHY-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMPNLNADPHY table

PACMSTKEODFIN-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMSTKEODFIN table

PACMSTKFNCFIN-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMSTKFNCFIN table

PACMSTKQCFMTM-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMSTKQCFMTM table

PALLOCNRUNMSG-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PALLOCNRUNMSG table

PAYREQN_HISTD-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_HISTD table

PCMMDTYVARDCS-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMDTYVARDCS table

PCMMDTYVARDIM-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMDTYVARDIM table

PCMMPNLBPSUM2-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLBPSUM2 table

PCMMPNLNACAL2-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLNACAL2 table

PCMMPNLNASUM2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPNLNASUM2 table

PCMMPOSVALCAL-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPOSVALCAL table

PLGSGLSUCCESS-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLGSGLSUCCESS table

PMFGICHISTORY-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMFGICHISTORY table

PMPEEXECHISTC-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPEEXECHISTC table

PMTMNETSTKFIN-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMTMNETSTKFIN table

PNSTKPREPDATA-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNSTKPREPDATA table

PVLOGPPRUNPR2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PVLOGPPRUNPR2 table

RPAYTPRPSLITM-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPAYTPRPSLITM table

CACMPNLDNAVALQ-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMPNLDNAVALQ table

CCMDTYFLPKTLOG-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMDTYFLPKTLOG table

CFIGRIRMONITOR-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIGRIRMONITOR table

CFIGRIRPROCESS-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIGRIRPROCESS table

CMM_ITEM_UOM_S-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_ITEM_UOM_S table

CMM_PNL_CALC_S-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_PNL_CALC_S table

CPRDTVACCSDOBJ-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRDTVACCSDOBJ table

CPRDTVACCSRVOB-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRDTVACCSRVOB table

CPRODSPLYITEMD-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRODSPLYITEMD table

CPURREQREPLMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQREPLMSG table

CRSHMNTSCHDACT-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRSHMNTSCHDACT table

FCO_OVHD_MSGDR-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCO_OVHD_MSGDR table

FKKBIX_MSG_GFN-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_MSG_GFN table

IACMNETSTKFINC-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMNETSTKFINC table

IACMPNLNADCUBE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMPNLNADCUBE table

IACMPNLVALCUBE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMPNLVALCUBE table

ICMDTYFLPKTLOG-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMDTYFLPKTLOG table

ICMMBPPNLVALUE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMBPPNLVALUE table

ICMMDTYMTMVAL2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMDTYMTMVAL2 table

ICMMNAPNLVALUE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMNAPNLVALUE table

IDMCCLOGMSGOLD-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMCCLOGMSGOLD table

IFIGRIRHISTORY-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGRIRHISTORY table

IFIGRIRPROCESS-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGRIRPROCESS table

IMRPMDISSUEBAS-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPMDISSUEBAS table

IPPGMOVEXCITEM-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: T100 Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPGMOVEXCITEM table

IPUBSECNOTEATT-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECNOTEATT table

IPURREQREPLMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQREPLMSG table

IRSHMNTSCHDACT-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRSHMNTSCHDACT table

ISGRIRPROCESS1-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: * Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGRIRPROCESS1 table

PACMCMMTMVALAS-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMCMMTMVALAS table

PACMCPETERMVAL-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMCPETERMVAL table

PACMMTMSTCKFIN-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMSTCKFIN table

PACMSTKLDCAPPD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMSTKLDCAPPD table

PACMSTKVALFUNC-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMSTKVALFUNC table

PBASFLTTRTINCU-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PBASFLTTRTINCU table

PCMMBPPNLVALUE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMBPPNLVALUE table

PCMMDTYMTMDODV-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMDTYMTMDODV table

PCMMDTYSTKDODV-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMDTYSTKDODV table

PCMMDTYVARFACT-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMDTYVARFACT table

PCMMNAPNLVALUE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMNAPNLVALUE table

PCPETERMVALSTK-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCPETERMVALSTK table

PFIGRIRHISTORY-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRHISTORY table

PFIGRIRPROCESS-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRPROCESS table

PFIGRIRPROCSIT-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRPROCSIT table

PFIRECNCLNSITN-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIRECNCLNSITN table

PMPEEXECHISTOA-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPEEXECHISTOA table

PMPEEXECHISTOP-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPEEXECHISTOP table

PNETBPPNLSTKTF-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNETBPPNLSTKTF table

PNETSTKMTMEXTN-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNETSTKMTMEXTN table

PPH_MRPISS_MAP-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPH_MRPISS_MAP table

PPMGAG_T_MSG_D-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPMGAG_T_MSG_D table

PPRMSGAGEENHCD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRMSGAGEENHCD table

PSTKMTMNETEXTN-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSTKMTMNETEXTN table

PVLOGPPOSRCKF2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PVLOGPPOSRCKF2 table

PVLOGPPOSRSKF2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PVLOGPPOSRSKF2 table

CACMPNLNAVALQRY-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMPNLNAVALQRY table

CCMMBPPNLVALQRY-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMBPPNLVALQRY table

CCMMNAPNLVALUE2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMNAPNLVALUE2 table

CCNSLDTNDCTSKLG-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message Number ▼ Description: ABAP System Field: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNSLDTNDCTSKLG table

CMMFDOF_D_FLMSG-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMFDOF_D_FLMSG table

CMM_ITEM_CURR_S-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_ITEM_CURR_S table

CMM_PNL_CALC1_S-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_PNL_CALC1_S table

CMM_PNL_CALC2_S-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_PNL_CALC2_S table

CMM_PNL_CALC3_S-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_PNL_CALC3_S table

CNETBPPNLVALUEQ-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNETBPPNLVALUEQ table

FCO_SETTLMSG_DR-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCO_SETTLMSG_DR table

FKKCOLLITEM_GFN-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKCOLLITEM_GFN table

IACMGRSSMTMSTKC-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMGRSSMTMSTKC table

IACMSTKMTMQCHRC-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMSTKMTMQCHRC table

ICAMDDISTRRECDS-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDDISTRRECDS table

ICAMDRECDWTHOBJ-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDRECDWTHOBJ table

ICMMBPPNLVALCUB-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMBPPNLVALCUB table

ICMMDTYMTMVALC2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMDTYMTMVALC2 table

ICMMDTYMTMVALE2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMDTYMTMVALE2 table

ICMMDTYMTMVALUE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMDTYMTMVALUE table

ICMMDTYSTKVALUE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMDTYSTKVALUE table

ICMMNAPNLVALCUB-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMNAPNLVALCUB table

ICMMNAPNLVALUE2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMNAPNLVALUE2 table

ICMMUNIONPFEXT2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMUNIONPFEXT2 table

ICNSLDTNDCTSKLG-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message Number ▼ Description: ABAP System Field: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNSLDTNDCTSKLG table

IMFGBOFACTNHIST-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBOFACTNHIST table

IMIGDATAINSTLOG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMIGDATAINSTLOG table

IMIGDATAINSTMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMIGDATAINSTMSG table

IMTMSTOCKFINDOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMTMSTOCKFINDOD table

IMTMSTOCKFINEOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMTMSTOCKFINEOD table

IPPKANBANCCCERR-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: T100 Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPKANBANCCCERR table

IPPKANBANCCIERR-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: T100 Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPKANBANCCIERR table

ISTOCKMTMFINDOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTOCKMTMFINDOD table

IUNIONMTMPFEXT2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IUNIONMTMPFEXT2 table

PACMBASFLTTRTCU-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMBASFLTTRTCU table

PACMBPPNLVALEXT-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMBPPNLVALEXT table

PACMCALCMTMDATA-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMCALCMTMDATA table

PACMELEBASEDATA-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMELEBASEDATA table

PACMMTMCONTRVAL-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMCONTRVAL table

PACMMTMSTKFINAS-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMSTKFINAS table

PACMMTMSTKFINGR-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMSTKFINGR table

PACMNETBPPNLCMD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMNETBPPNLCMD table

PACMNETPNLFINAL-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMNETPNLFINAL table

PACMPNLNAVALEXT-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMPNLNAVALEXT table

PACMPNLNAVALUPD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMPNLNAVALUPD table

PACMSTKDPQSVALO-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMSTKDPQSVALO table

PAYREQN_INB_MSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_INB_MSG table

PCMMBPPNLVALUE2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMBPPNLVALUE2 table

PCMMDTYMTMDODV2-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMDTYMTMDODV2 table

PCMMDTYMTMVALF2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMDTYMTMVALF2 table

PCMMNAPNLVALUE2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMNAPNLVALUE2 table

PCONVCNDTRMINCU-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCONVCNDTRMINCU table

PFIGRIRHISFCHNG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRHISFCHNG table

PFIGRIRHISLCHNG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRHISLCHNG table

PFIGRIRMONITOR1-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRMONITOR1 table

PMPEEXECHISTOA2-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPEEXECHISTOA2 table

PMPEEXECHISTORD-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPEEXECHISTORD table

PMTMSTOCKFINDOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMTMSTOCKFINDOD table

PMTMSTOCKFINEOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMTMSTOCKFINEOD table

PNETSTKMTMFINAL-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNETSTKMTMFINAL table

PNSTKVALVOLSCHN-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNSTKVALVOLSCHN table

PPMGAG_T_APPMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPMGAG_T_APPMSG table

PSTKMTMNETFINAL-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSTKMTMNETFINAL table

PVLOGPPOSINDOD2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PVLOGPPOSINDOD2 table

PVLOGPQSQPDADJ2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PVLOGPQSQPDADJ2 table

PVLOGPRDYRMNTH2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PVLOGPRDYRMNTH2 table

CACMNETBPPNLVALQ-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMNETBPPNLVALQ table

CCMDTYFLPKTLOGTP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMDTYFLPKTLOGTP table

CCMMPOSVALRSKQRY-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMPOSVALRSKQRY table

CCNSLDTNRCLTSKLG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNSLDTNRCLTSKLG table

CMM_S_NAPNL_AGGR-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_NAPNL_AGGR table

CMM_S_NAPNL_CALC-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_NAPNL_CALC table

CMM_S_QP_QG_AGGR-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_QP_QG_AGGR table

FINS_GRIRPROCHIS-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: * Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_GRIRPROCHIS table

IACMNETSTKFINDOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMNETSTKFINDOD table

IACMNETSTKFINEOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMNETSTKFINEOD table

IASSTMTMDLGENERR-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IASSTMTMDLGENERR table

ICAMDRECDWTHRATG-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDRECDWTHRATG table

ICMDTYFLPKTLOGTP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMDTYFLPKTLOGTP table

ICMMBPPNLVALCUBE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMBPPNLVALCUBE table

ICMMDTYMTMVALUEC-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMDTYMTMVALUEC table

ICMMDTYMTMVALUEE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMDTYMTMVALUEE table

ICMMDTYSTKVALUEC-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMDTYSTKVALUEC table

ICMMDTYSTKVALUEE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMDTYSTKVALUEE table

ICMMNAPNLVALCUB2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMNAPNLVALCUB2 table

ICMMPOSVALRSKCUB-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMPOSVALRSKCUB table

ICMMUNIONPFCUBE2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMUNIONPFCUBE2 table

ICNSLDTNRCLTSKLG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNSLDTNRCLTSKLG table

ICTRNETBPPNLCUBE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICTRNETBPPNLCUBE table

IDMCCLGITMMSGCAT-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMCCLGITMMSGCAT table

IFAILDGMOVEXCITM-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: T100 Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFAILDGMOVEXCITM table

IILSTRPTAXITMLOG-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IILSTRPTAXITMLOG table

IMTMNETSTKFINDOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMTMNETSTKFINDOD table

IMTMNETSTKFINEOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMTMNETSTKFINEOD table

IPSMS4CPCMTADJTP-SYSTEMMESSAGENUMBER table field - Application Log: Message number in message class ▼ Description: Application Log: Message number in message class Field Name: SYSTEMMESSAGENUMBER Data Element: BALMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSMS4CPCMTADJTP table

IRSHMNTSCHDACTTP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRSHMNTSCHDACTTP table

ISDCOLPROCERRLOG-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCOLPROCERRLOG table

ISGRIRPROCESS1_D-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: * Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGRIRPROCESS1_D table

ISTOCKMTMFINEODC-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTOCKMTMFINEODC table

IUNIONMTMPFCUBE2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IUNIONMTMPFCUBE2 table

MAINTORDCONFMS_D-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTORDCONFMS_D table

PACMCMMDTSTKVALE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMCMMDTSTKVALE table

PACMCMMSTKVALFNL-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMCMMSTKVALFNL table

PACMCONVCNDTRMCU-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMCONVCNDTRMCU table

PACMCTRPNLVALFNC-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMCTRPNLVALFNC table

PACMCTRPNLVALFNL-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMCTRPNLVALFNL table

PACMMTMBASFLTMKT-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMBASFLTMKT table

PACMMTMELEFINALD-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMELEFINALD table

PACMMTMELELESBAS-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMELELESBAS table

PACMMTMNETSTKFIN-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMNETSTKFIN table

PACMMTMNSTKFNDOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMNSTKFNDOD table

PACMMTMNSTKFNEOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMNSTKFNEOD table

PACMMTMSTKFINDOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMSTKFINDOD table

PACMMTMSTKFINEOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMSTKFINEOD table

PACMMTMSTKQCFDOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMSTKQCFDOD table

PACMMTMSTKQCFEOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMSTKQCFEOD table

PACMMTMSTKQCFFIN-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMSTKQCFFIN table

PACMNETPNLTRMVAL-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMNETPNLTRMVAL table

PACMNETPNLUNAPLD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMNETPNLUNAPLD table

PACMSTKFINDODASO-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMSTKFINDODASO table

PACMSTKFINEODASO-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMSTKFINEODASO table

PACMSTKFNCDODFIN-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMSTKFNCDODFIN table

PAYREQN_STGHISTD-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_STGHISTD table

PCMMDTYMTMVALUEF-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMDTYMTMVALUEF table

PCMMDTYSTKVALUEF-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMDTYSTKVALUEF table

PGRIRHISTPRDCCSR-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PGRIRHISTPRDCCSR table

PMPECMPASSYCHIST-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPECMPASSYCHIST table

PMPECOMPASSYHIST-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPECOMPASSYHIST table

PMPEEXECHISTORDH-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPEEXECHISTORDH table

PMPEEXECHISTORDP-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPEEXECHISTORDP table

PMTMNETSTKFINDOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMTMNETSTKFINDOD table

PMTMNETSTKFINEOD-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMTMNETSTKFINEOD table

PNETBPPNLTERMVAL-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNETBPPNLTERMVAL table

PNETPNLUNAPLAPPS-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNETPNLUNAPLAPPS table

PSM_D_PCMTAD_ACT-SYSTEMMESSAGENUMBER table field - Application Log: Message number in message class ▼ Description: Application Log: Message number in message class Field Name: SYSTEMMESSAGENUMBER Data Element: BALMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSM_D_PCMTAD_ACT table

PSTKMTMBASFLTMKT-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSTKMTMBASFLTMKT table

PSTKMTMELEFINALD-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSTKMTMELEFINALD table

PSTKMTMELELESBAS-SYSTEMMESSAGENUMBER table field - ▼ Description: Field Name: SYSTEMMESSAGENUMBER Data Element: Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSTKMTMELELESBAS table

PSTKQLTYCHARSMTM-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSTKQLTYCHARSMTM table

PVLOGPPOSREPEKF2-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: CDS_SYSTEMMESSAGENUMBER Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PVLOGPPOSREPEKF2 table

VCMMFDOF_D_FLMSG-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VCMMFDOF_D_FLMSG table

VPPMGAG_T_APPMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: * Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VPPMGAG_T_APPMSG table

/S4PPM/TS_MESSAGE-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /S4PPM/TS_MESSAGE table

CMM_CALC_QP_SUM_S-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_CALC_QP_SUM_S table

MDC_IMPORT_ACTION-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDC_IMPORT_ACTION table

PAYREQN_S_MESSAGE-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_S_MESSAGE table

PAYREQN_S_PAY_MSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_S_PAY_MSG table

BAPIEBDRREQUESTMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIEBDRREQUESTMSG table

CMM_CALC_MTM_VAL_S-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_CALC_MTM_VAL_S table

CMM_PNL_PREP_EXT_S-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_PNL_PREP_EXT_S table

CMM_S_CALC_MTM_VAL-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_CALC_MTM_VAL table

FARR_S_API_MESSAGE-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FARR_S_API_MESSAGE table

FINSS_GRIRPROC_MSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINSS_GRIRPROC_MSG table

FKKBIXBIT0_MSG_GFN-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXBIT0_MSG_GFN table

FKKBIXBIT2_MSG_GFN-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXBIT2_MSG_GFN table

FKKBIXCIT2_MSG_GFN-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXCIT2_MSG_GFN table

FKKBIX_BIP_MSG_GFN-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_BIP_MSG_GFN table

FKKINV_CFC_MSG_GFN-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_CFC_MSG_GFN table

JVA_OCF_S_MESSAGES-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP JVA_OCF_S_MESSAGES table

CMM_CALC_DOC_CURR_S-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_CALC_DOC_CURR_S table

CMM_S_CALC_DOC_CURR-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_CALC_DOC_CURR table

CMM_S_NAPNL_CALC_01-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_NAPNL_CALC_01 table

CMM_S_NAPNL_CALC_02-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_NAPNL_CALC_02 table

CMM_S_NAPNL_CALC_03-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_NAPNL_CALC_03 table

CMM_S_NAPNL_MAP_MTM-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_NAPNL_MAP_MTM table

ISMFGGDSMVTEXCPTNTP-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: * Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGDSMVTEXCPTNTP table

CMM_CALC_DELTA_STK_S-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_CALC_DELTA_STK_S table

CMM_CALC_DELTA_VAL_S-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_CALC_DELTA_VAL_S table

CMM_CALC_TERM_RATE_S-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_CALC_TERM_RATE_S table

CMM_CPE_QP_QG_CALC_S-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_CPE_QP_QG_CALC_S table

CMM_QP_QG_ITM_QUOT_S-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_QP_QG_ITM_QUOT_S table

CMM_S_CALC_DELTA_STK-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_CALC_DELTA_STK table

CMM_S_CALC_DELTA_VAL-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_CALC_DELTA_VAL table

CMM_S_CALC_TERM_RATE-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_CALC_TERM_RATE table

CMM_S_NAPNL_IMP_AGGR-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_NAPNL_IMP_AGGR table

CMM_S_NAPNL_PREP_EXT-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_NAPNL_PREP_EXT table

CMM_S_QP_QG_CONV_CUR-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_QP_QG_CONV_CUR table

CMM_S_QP_QG_CONV_UOM-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_QP_QG_CONV_UOM table

ISMASTERDATAIMPORTTP-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: * Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMASTERDATAIMPORTTP table

CMM_BEGPOS_PREP_PNL_S-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_BEGPOS_PREP_PNL_S table

CMM_S_TERM_PROCESSING-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_TERM_PROCESSING table

CNDNRECDACCESSDETNLOG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNDNRECDACCESSDETNLOG table

CNDNRECDDETNDETAILLOG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNDNRECDDETNDETAILLOG table

ISMFGGDSMVTEXCPTNTP_D-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGDSMVTEXCPTNTP_D table

ISPUBLICSECTORNOTETP2-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORNOTETP2 table

MDC_IMPORT_ATTRIBUTES-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: * Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDC_IMPORT_ATTRIBUTES table

MMPUR_S_CCTR_DISTRMSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_DISTRMSG table

CMM_S_CALC_MTM_VAL_STK-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_CALC_MTM_VAL_STK table

ISCAINVCGCLRFCTNCASETP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAINVCGCLRFCTNCASETP table

ISMASTERDATAIMPORTTP_D-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: * Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMASTERDATAIMPORTTP_D table

ISMFGGDSMVTEXCPTNTP_DR-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGDSMVTEXCPTNTP_DR table

PAYREQN_S_REQN_HISTORY-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_S_REQN_HISTORY table

SDBIL_EBDR_REQUEST_MSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDBIL_EBDR_REQUEST_MSG table

CMM_S_NAPNL_MAP_MTM_IMP-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_NAPNL_MAP_MTM_IMP table

CNDNAMOUNTDETNLOGRESULT-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNDNAMOUNTDETNLOGRESULT table

CNDNAMOUNTDETNLOGRESULT-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNDNAMOUNTDETNLOGRESULT table

CNDNAMOUNTDETNLOGRESULT-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNDNAMOUNTDETNLOGRESULT table

ISMAINTORDCONFMESSAGETP-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: * Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDCONFMESSAGETP table

ISMRPMASTERDATAISSUETP5-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: * Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMRPMASTERDATAISSUETP5 table

ISPUBLICSECTORNOTETP2_D-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORNOTETP2_D table

MMPUR_PO_FOD_S_MESSAGES-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PO_FOD_S_MESSAGES table

CMM_S_BPPNL_PROC_PREPARE-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_BPPNL_PROC_PREPARE table

CMM_S_CALC_DELTA_VAL_STK-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_CALC_DELTA_VAL_STK table

CMM_S_CALC_VAL_STAT_CURR-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_CALC_VAL_STAT_CURR table

CMM_S_QP_QG_PRICE_QUOTES-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_QP_QG_PRICE_QUOTES table

FINSS_GRIRACCOUNTRCN_ENH-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: * Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINSS_GRIRACCOUNTRCN_ENH table

ISCAINVCGCLRFCTNCASETP_D-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAINVCGCLRFCTNCASETP_D table

ISPUBLICSECTORNOTETP2_DR-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORNOTETP2_DR table

FINSS_GRIRPROC_STATUS_ENH-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: * Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINSS_GRIRPROC_STATUS_ENH table

ISCAINVCGCLRFCTNCASETP_DR-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAINVCGCLRFCTNCASETP_DR table

ISMAINTORDCONFMESSAGETP_D-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDCONFMESSAGETP_D table

ISMRPMASTERDATAISSUETP5_D-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMRPMASTERDATAISSUETP5_D table

PAYREQN_S_INBOUND_PAY_MSG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_S_INBOUND_PAY_MSG table

CMM_S_BPPNL_PROC_AGGREGATE-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_BPPNL_PROC_AGGREGATE table

CNDNRECORDDETERMINATIONLOG-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNDNRECORDDETERMINATIONLOG table

FKKBIX_RATING_ITEM_MSG_GFN-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_RATING_ITEM_MSG_GFN table

ISMAINTORDCONFMESSAGETP_DR-SYSTEMMESSAGENUMBER table field - Message number ▼ Description: Message number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNR Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDCONFMESSAGETP_DR table

ISMFGGOODSMOVEMENTEXCPTNTP-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: * Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGOODSMOVEMENTEXCPTNTP table

ISPUBSECPERIODICCMTMTADJTP-SYSTEMMESSAGENUMBER table field - Application Log: Message number in message class ▼ Description: Application Log: Message number in message class Field Name: SYSTEMMESSAGENUMBER Data Element: BALMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBSECPERIODICCMTMTADJTP table

ISPUBLICSECTORBRFMESSAGETP2-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2 table

CMM_S_BPPNL_PROC_PRE_PROCESS-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_BPPNL_PROC_PRE_PROCESS table

ISMFGGOODSMOVEMENTEXCPTNTP_D-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGOODSMOVEMENTEXCPTNTP_D table

ISPUBSECPERIODICCMTMTADJTP_D-SYSTEMMESSAGENUMBER table field - Application Log: Message number in message class ▼ Description: Application Log: Message number in message class Field Name: SYSTEMMESSAGENUMBER Data Element: BALMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBSECPERIODICCMTMTADJTP_D table

ISRSHMAINTSCHEDACTIVITYLOGTP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRSHMAINTSCHEDACTIVITYLOGTP table

ISRUNSETTLEMENTACTLMESSAGETP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNSETTLEMENTACTLMESSAGETP table

CMM_S_BPPNL_TERM_CALC_DLT_VAL-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_BPPNL_TERM_CALC_DLT_VAL table

CMM_S_BPPNL_TERM_CALC_MTM_VAL-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_BPPNL_TERM_CALC_MTM_VAL table

CMM_S_BPPNL_TERM_CAL_VAL_STAT-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_BPPNL_TERM_CAL_VAL_STAT table

CMM_S_BPPNL_TERM_MRG_DLTA_STK-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_BPPNL_TERM_MRG_DLTA_STK table

ISCOMMODITYORDFILLPACKETLOGTP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOMMODITYORDFILLPACKETLOGTP table

ISMFGGOODSMOVEMENTEXCPTNTP_DR-SYSTEMMESSAGENUMBER table field - System Message Number ▼ Description: System Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: MSGNO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MSGNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGOODSMOVEMENTEXCPTNTP_DR table

ISPREPAYMENTPOSTINGMESSAGESTP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPREPAYMENTPOSTINGMESSAGESTP table

ISPUBLICSECTORBRFMESSAGETP2_D-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2_D table

CMM_S_BPPNL_TERM_VAL_STAT_CURR-SYSTEMMESSAGENUMBER table field - ABAP System Field: Message ID ▼ Description: ABAP System Field: Message ID Field Name: SYSTEMMESSAGENUMBER Data Element: SYST_MSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_BPPNL_TERM_VAL_STAT_CURR table

ISCOMMODITYORDFILLPACKETLOGT_D-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOMMODITYORDFILLPACKETLOGT_D table

ISCONTROLLINGOVERHEADMESSAGETP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONTROLLINGOVERHEADMESSAGETP table

ISCONTROLLINGOVERHEADMESSAGE_D-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONTROLLINGOVERHEADMESSAGE_D table

ISCONTROLLINGOVERHEADMESSAG_DR-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONTROLLINGOVERHEADMESSAG_DR table

ISK_CONTROLLINGOVERHEADMESSAGE-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISK_CONTROLLINGOVERHEADMESSAGE table

ISK_PUBLICSECTORBRFMESSAGETP_3-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISK_PUBLICSECTORBRFMESSAGETP_3 table

ISK_RUNSETTLEMENTACTLMESSAGETP-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISK_RUNSETTLEMENTACTLMESSAGETP table

ISPREPAYMENTPOSTINGMESSAGEST_D-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPREPAYMENTPOSTINGMESSAGEST_D table

ISPREPAYMENTPOSTINGMESSAGES_DR-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPREPAYMENTPOSTINGMESSAGES_DR table

ISPUBLICSECTORBRFMESSAGETP2_DR-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2_DR table

ISRSHMAINTSCHEDACTIVITYLOGT5_D-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRSHMAINTSCHEDACTIVITYLOGT5_D table

ISRUNSETTLEMENTACTLMESSAGETP_D-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNSETTLEMENTACTLMESSAGETP_D table

ISRUNSETTLEMENTACTLMESSAGET_DR-SYSTEMMESSAGENUMBER table field - Message Number ▼ Description: Message Number Field Name: SYSTEMMESSAGENUMBER Data Element: SYMSGNO Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: SYMSGNO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNSETTLEMENTACTLMESSAGET_DR table