SAP SYSTEMMESSAGETEXT field - Message Text details in SAP

Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211

Details

CDMVALMSG-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMVALMSG table

CMFGGMETP-SYSTEMMESSAGETEXT table field - Error Message ▼ Description: Error Message Field Name: SYSTEMMESSAGETEXT Data Element: MPE_GOODS_MVMT_ERROR_MESSAGE Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: TEXT255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMFGGMETP table

CMTMPFQRY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMTMPFQRY table

CDMCITMMSG-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMCITMMSG table

CRSHOPRVAL-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRSHOPRVAL table

CDMVALMSGSUM-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMVALMSGSUM table

CMTMPFDODQRY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMTMPFDODQRY table

CMTMPFEODQRY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMTMPFEODQRY table

INOMTKERRLOG-SYSTEMMESSAGETEXT table field - ▼ Description: Field Name: SYSTEMMESSAGETEXT Data Element: Data Type: CHAR length (Dec): 200(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOMTKERRLOG table

CACMMTMLOGCUR-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMMTMLOGCUR table

CACMMTMLOGDOD-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMMTMLOGDOD table

CACMMTMLOGEOD-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMMTMLOGEOD table

CCMMPOSCURQRY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMPOSCURQRY table

CCMMPOSDODQRY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMPOSDODQRY table

CCMMPOSEODQRY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMPOSEODQRY table

CCOMTMLCURQRY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOMTMLCURQRY table

CCOMTMLDODQRY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOMTMLDODQRY table

CCOMTMLEODQRY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOMTMLEODQRY table

CCOMTMSEODQRY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOMTMSEODQRY table

CACMSTKMTMQLTY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMSTKMTMQLTY table

CCMMBPPNLVALUE-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMBPPNLVALUE table

CCMMNAPNLVALUE-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMNAPNLVALUE table

IACMMTMVALCUBE-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMMTMVALCUBE table

IFIGRIRMONITOR-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGRIRMONITOR table

PACMMTMVALCUBE-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACMMTMVALCUBE table

CDRVTVMTMCURQRY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDRVTVMTMCURQRY table

CDRVTVMTMEODQRY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDRVTVMTMEODQRY table

CCMMMTMSTKEODQRY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMMTMSTKEODQRY table

CFSITEMMAPHDRDEF-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFSITEMMAPHDRDEF table

CFSITEMMAPITMDEF-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFSITEMMAPITMDEF table

IFSITEMMAPITMDEF-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFSITEMMAPITMDEF table

PFSITEMMAPHDRDEF-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFSITEMMAPHDRDEF table

PFSITEMMAPITMDEF-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFSITEMMAPITMDEF table

CMAINORDR-SYSTEMMESSAGETEXT table field - ▼ Description: Field Name: SYSTEMMESSAGETEXT Data Element: Data Type: CHAR length (Dec): 300(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMAINORDR table

CMDIMPORT-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDIMPORT table

CPPMGAPMS-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPPMGAPMS table

PCONTRMTM-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCONTRMTM table

ADISTRMSGS-SYSTEMMESSAGETEXT table field - ▼ Description: Field Name: SYSTEMMESSAGETEXT Data Element: Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ADISTRMSGS table

CACMMTMEOD-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMMTMEOD table

CBDLIF0798-SYSTEMMESSAGETEXT table field - Issue Details (Text) ▼ Description: Issue Details (Text) Field Name: SYSTEMMESSAGETEXT Data Element: SDCI_ODATA_ISSUE_TEXT Data Type: CHAR length (Dec): 256(0) Check table: Conversion Routine: Domain Name: CHAR256 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBDLIF0798 table

CBDOCF0797-SYSTEMMESSAGETEXT table field - Issue Details (Text) ▼ Description: Issue Details (Text) Field Name: SYSTEMMESSAGETEXT Data Element: SDCI_ODATA_ISSUE_TEXT Data Type: CHAR length (Dec): 256(0) Check table: Conversion Routine: Domain Name: CHAR256 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBDOCF0797 table

CDISTRMSGS-SYSTEMMESSAGETEXT table field - ▼ Description: Field Name: SYSTEMMESSAGETEXT Data Element: Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDISTRMSGS table

CDMVALMSGX-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMVALMSGX table

CMTMPFQRY2-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMTMPFQRY2 table

CRFMOFAJMD-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMOFAJMD table

CTKTERRLOG-SYSTEMMESSAGETEXT table field - ▼ Description: Field Name: SYSTEMMESSAGETEXT Data Element: Data Type: CHAR length (Dec): 200(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTKTERRLOG table

IDISTRMSGS-SYSTEMMESSAGETEXT table field - ▼ Description: Field Name: SYSTEMMESSAGETEXT Data Element: Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDISTRMSGS table

MDC_IMPORT-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDC_IMPORT table

PSBRFMSGTP-SYSTEMMESSAGETEXT table field - System Text ▼ Description: System Text Field Name: SYSTEMMESSAGETEXT Data Element: PS_SYSTEM_MSG_TEXT Data Type: SSTR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: SSTRING MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSBRFMSGTP table

CPMUPDTMSGS-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPMUPDTMSGS table

IMDIMPORTTP-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMDIMPORTTP table

IMTMMESSAGE-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMTMMESSAGE table

IPPMGAPMSTP-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMGAPMSTP table

PFSIMAPHDRD-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFSIMAPHDRD table

CCRDTCTRLMSG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCRDTCTRLMSG table

CJITAPPLAREA-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CJITAPPLAREA table

CMTMSTOCKFIN-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMTMSTOCKFIN table

CSIMLNSTSCNT-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSIMLNSTSCNT table

IACMCMVALCUB-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMCMVALCUB table

IJITAPPLAREA-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IJITAPPLAREA table

ILCMMESSAGES-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILCMMESSAGES table

IPPMGAPPRMSG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMGAPPRMSG table

CALLOCNRUNMSG-SYSTEMMESSAGETEXT table field - Allocation Run Message Text ▼ Description: Allocation Run Message Text Field Name: SYSTEMMESSAGETEXT Data Element: FCO_ALLOC_RUN_MSG_TEXT Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CALLOCNRUNMSG table

CCTRLGOVHDMSG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: MSGTXT_LONG Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: TEXT255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCTRLGOVHDMSG table

CMTMNETSTKFIN-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMTMNETSTKFIN table

CMTMPFDODQRY2-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMTMPFDODQRY2 table

CMTMPFEODQRY2-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMTMPFEODQRY2 table

CORDRCONFMSGS-SYSTEMMESSAGETEXT table field - ▼ Description: Field Name: SYSTEMMESSAGETEXT Data Element: Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CORDRCONFMSGS table

CPRODSPLYITEM-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRODSPLYITEM table

CSTOCKMTMFINQ-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSTOCKMTMFINQ table

CUSRDEFMSGLOG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CUSRDEFMSGLOG table

FINS_GRIRPROC-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_GRIRPROC table

IORDRCONFMSGS-SYSTEMMESSAGETEXT table field - ▼ Description: Field Name: SYSTEMMESSAGETEXT Data Element: Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IORDRCONFMSGS table

IPAYTPRPSLMSG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYTPRPSLMSG table

IUSRDEFMSGLOG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IUSRDEFMSGLOG table

PALLOCNRUNMSG-SYSTEMMESSAGETEXT table field - Allocation Run Message Text ▼ Description: Allocation Run Message Text Field Name: SYSTEMMESSAGETEXT Data Element: FCO_ALLOC_RUN_MSG_TEXT Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PALLOCNRUNMSG table

PPAYTPRPSLMSG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPAYTPRPSLMSG table

CACMMTMSTKEODQ-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMMTMSTKEODQ table

CACMNETSTKFINQ-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMNETSTKFINQ table

CCMMPOSCURQRY2-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMPOSCURQRY2 table

CCMMPOSDODQRY2-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMPOSDODQRY2 table

CCMMPOSEODQRY2-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMPOSEODQRY2 table

CCOMTMLCURQRY2-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOMTMLCURQRY2 table

CCOMTMLDODQRY2-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOMTMLDODQRY2 table

CCOMTMLEODQRY2-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOMTMLEODQRY2 table

CCOSTOCKEODQRY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOSTOCKEODQRY table

CFIGRIRMONITOR-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIGRIRMONITOR table

CFIGRIRPROCESS-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIGRIRPROCESS table

CPRODSPLYITEMD-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRODSPLYITEMD table

CPURREQREPLMSG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQREPLMSG table

FCO_OVHD_MSGDR-SYSTEMMESSAGETEXT table field - Application Log: Formatted message text ▼ Description: Application Log: Formatted message text Field Name: SYSTEMMESSAGETEXT Data Element: BALTMSG Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: BALTMSG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCO_OVHD_MSGDR table

IACMMTMMESSAGE-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACMMTMMESSAGE table

ICMDTYFLPKTLOG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMDTYFLPKTLOG table

IFIGRIRHISTORY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGRIRHISTORY table

IFIGRIRPROCESS-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGRIRPROCESS table

IPURREQREPLMSG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQREPLMSG table

IRSHACTYLOGMSG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRSHACTYLOGMSG table

IRSHORDMESSAGE-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRSHORDMESSAGE table

ISGRIRPROCESS1-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGRIRPROCESS1 table

PFIGRIRHISTORY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRHISTORY table

PFIGRIRPROCESS-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRPROCESS table

PFIRECNCLNSITN-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIRECNCLNSITN table

PPMGAG_T_MSG_D-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPMGAG_T_MSG_D table

CACMCMMTMLOGCUR-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMCMMTMLOGCUR table

CACMCMMTMLOGDOD-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMCMMTMLOGDOD table

CACMSTKMTMQLTYQ-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMSTKMTMQLTYQ table

CCAMSTRDATAITMS-SYSTEMMESSAGETEXT table field - ▼ Description: Field Name: SYSTEMMESSAGETEXT Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAMSTRDATAITMS table

CCMMBPPNLVALQRY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMBPPNLVALQRY table

CCMMNAPNLVALUE2-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMNAPNLVALUE2 table

CJITCALLCBFLUSH-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CJITCALLCBFLUSH table

CMMFDOF_D_FLMSG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMFDOF_D_FLMSG table

CMTMSTOCKFINDOD-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMTMSTOCKFINDOD table

CMTMSTOCKFINEOD-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMTMSTOCKFINEOD table

CPUBSECBRFMSGTP-SYSTEMMESSAGETEXT table field - System Text ▼ Description: System Text Field Name: SYSTEMMESSAGETEXT Data Element: PS_SYSTEM_MSG_TEXT Data Type: SSTR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: SSTRING MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPUBSECBRFMSGTP table

CSTOCKMTMFINDOD-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSTOCKMTMFINDOD table

FCO_SETTLMSG_DR-SYSTEMMESSAGETEXT table field - Application Log: Formatted message text ▼ Description: Application Log: Formatted message text Field Name: SYSTEMMESSAGETEXT Data Element: BALTMSG Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: BALTMSG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCO_SETTLMSG_DR table

ICAMDDISTRRECDS-SYSTEMMESSAGETEXT table field - Long Text as String ▼ Description: Long Text as String Field Name: SYSTEMMESSAGETEXT Data Element: MESSAGE_STRING_KK Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: STRING MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDDISTRRECDS table

ICAMDRECDWTHOBJ-SYSTEMMESSAGETEXT table field - Long Text as String ▼ Description: Long Text as String Field Name: SYSTEMMESSAGETEXT Data Element: MESSAGE_STRING_KK Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: STRING MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDRECDWTHOBJ table

ICTRLGOVHDMSGTP-SYSTEMMESSAGETEXT table field - Application Log: Formatted message text ▼ Description: Application Log: Formatted message text Field Name: SYSTEMMESSAGETEXT Data Element: BALTMSG Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: BALTMSG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICTRLGOVHDMSGTP table

IFSIMAPHDRDRAFT-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFSIMAPHDRDRAFT table

IFSIMAPITMDRAFT-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFSIMAPITMDRAFT table

IPUBSECBRFMSGTP-SYSTEMMESSAGETEXT table field - System Text ▼ Description: System Text Field Name: SYSTEMMESSAGETEXT Data Element: PS_SYSTEM_MSG_TEXT Data Type: SSTR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: SSTRING MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECBRFMSGTP table

PFIGRIRHISFCHNG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRHISFCHNG table

PFIGRIRHISLCHNG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRHISLCHNG table

PFSIMAPDRFTITEM-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFSIMAPDRFTITEM table

PPMGAG_T_APPMSG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPMGAG_T_APPMSG table

CACMNETSTKFINDOD-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMNETSTKFINDOD table

CACMNETSTKFINEOD-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACMNETSTKFINEOD table

CCMDTYFLPKTLOGTP-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMDTYFLPKTLOGTP table

CCMMPOSVALRSKQRY-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMMPOSVALRSKQRY table

CMTMNETSTKFINDOD-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMTMNETSTKFINDOD table

CMTMNETSTKFINEOD-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMTMNETSTKFINEOD table

CSETTLMNTACTMESG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: MSGTXT_LONG Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: TEXT255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSETTLMNTACTMESG table

CSTOCKMTMFINEODQ-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSTOCKMTMFINEODQ table

FINCS_FSIM_HDR_D-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINCS_FSIM_HDR_D table

FINCS_FSIM_ITM_D-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINCS_FSIM_ITM_D table

FINS_GRIRPROCHIS-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_GRIRPROCHIS table

ICAMDRECDWTHRATG-SYSTEMMESSAGETEXT table field - Long Text as String ▼ Description: Long Text as String Field Name: SYSTEMMESSAGETEXT Data Element: MESSAGE_STRING_KK Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: STRING MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDRECDWTHRATG table

ICMDTYFLPKTLOGTP-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMDTYFLPKTLOGTP table

IFSITEMMAPHDRDEF-SYSTEMMESSAGETEXT table field - Char255 ▼ Description: Char255 Field Name: SYSTEMMESSAGETEXT Data Element: CHAR255 Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CHAR255 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFSITEMMAPHDRDEF table

ISETTLMNTACTMESG-SYSTEMMESSAGETEXT table field - Application Log: Formatted message text ▼ Description: Application Log: Formatted message text Field Name: SYSTEMMESSAGETEXT Data Element: BALTMSG Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: BALTMSG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISETTLMNTACTMESG table

ISGRIRPROCESS1_D-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGRIRPROCESS1_D table

MAINTORDCONFMS_D-SYSTEMMESSAGETEXT table field - ▼ Description: Field Name: SYSTEMMESSAGETEXT Data Element: Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTORDCONFMS_D table

VCMMFDOF_D_FLMSG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VCMMFDOF_D_FLMSG table

VPPMGAG_T_APPMSG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VPPMGAG_T_APPMSG table

MDC_IMPORT_ACTION-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDC_IMPORT_ACTION table

BAPIEBDRREQUESTMSG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIEBDRREQUESTMSG table

FINSS_GRIRPROC_MSG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINSS_GRIRPROC_MSG table

JVA_OCF_S_MESSAGES-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP JVA_OCF_S_MESSAGES table

ISMASTERDATAIMPORTTP-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMASTERDATAIMPORTTP table

CNDNRECDDETNDETAILLOG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNDNRECDDETNDETAILLOG table

MDC_IMPORT_ATTRIBUTES-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDC_IMPORT_ATTRIBUTES table

MMPUR_S_CCTR_DISTRMSG-SYSTEMMESSAGETEXT table field - ▼ Description: Field Name: SYSTEMMESSAGETEXT Data Element: Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_DISTRMSG table

ISMASTERDATAIMPORTTP_D-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMASTERDATAIMPORTTP_D table

SDBIL_EBDR_REQUEST_MSG-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDBIL_EBDR_REQUEST_MSG table

CNDNAMOUNTDETNLOGRESULT-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNDNAMOUNTDETNLOGRESULT table

ISMAINTORDCONFMESSAGETP-SYSTEMMESSAGETEXT table field - ▼ Description: Field Name: SYSTEMMESSAGETEXT Data Element: Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDCONFMESSAGETP table

MMPUR_PO_FOD_S_MESSAGES-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PO_FOD_S_MESSAGES table

FINSS_GRIRACCOUNTRCN_ENH-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINSS_GRIRACCOUNTRCN_ENH table

FINSS_GRIRPROC_STATUS_ENH-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: NATXT Data Type: CHAR length (Dec): 73(0) Check table: Conversion Routine: Domain Name: NATXT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINSS_GRIRPROC_STATUS_ENH table

ISMAINTORDCONFMESSAGETP_D-SYSTEMMESSAGETEXT table field - ▼ Description: Field Name: SYSTEMMESSAGETEXT Data Element: Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDCONFMESSAGETP_D table

FKKBIX_RATING_ITEM_MSG_GFN-SYSTEMMESSAGETEXT table field - Long Text as String ▼ Description: Long Text as String Field Name: SYSTEMMESSAGETEXT Data Element: MESSAGE_STRING_KK Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: STRING MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_RATING_ITEM_MSG_GFN table

ISMAINTORDCONFMESSAGETP_DR-SYSTEMMESSAGETEXT table field - ▼ Description: Field Name: SYSTEMMESSAGETEXT Data Element: Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDCONFMESSAGETP_DR table

ISPUBLICSECTORBRFMESSAGETP2-SYSTEMMESSAGETEXT table field - System Text ▼ Description: System Text Field Name: SYSTEMMESSAGETEXT Data Element: PS_SYSTEM_MSG_TEXT Data Type: SSTR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: SSTRING MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2 table

FINCS_S_ODATA_IM_FSIMAP_ITEM-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINCS_S_ODATA_IM_FSIMAP_ITEM table

ISRUNSETTLEMENTACTLMESSAGETP-SYSTEMMESSAGETEXT table field - Application Log: Formatted message text ▼ Description: Application Log: Formatted message text Field Name: SYSTEMMESSAGETEXT Data Element: BALTMSG Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: BALTMSG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNSETTLEMENTACTLMESSAGETP table

ISCOMMODITYORDFILLPACKETLOGTP-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOMMODITYORDFILLPACKETLOGTP table

ISPREPAYMENTPOSTINGMESSAGESTP-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPREPAYMENTPOSTINGMESSAGESTP table

ISPUBLICSECTORBRFMESSAGETP2_D-SYSTEMMESSAGETEXT table field - System Text ▼ Description: System Text Field Name: SYSTEMMESSAGETEXT Data Element: PS_SYSTEM_MSG_TEXT Data Type: SSTR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: SSTRING MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2_D table

MMPUR_OA_CCTR_TRANS_STRUCTURE-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OA_CCTR_TRANS_STRUCTURE table

ISCOMMODITYORDFILLPACKETLOGT_D-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOMMODITYORDFILLPACKETLOGT_D table

ISCONTROLLINGOVERHEADMESSAGETP-SYSTEMMESSAGETEXT table field - Application Log: Formatted message text ▼ Description: Application Log: Formatted message text Field Name: SYSTEMMESSAGETEXT Data Element: BALTMSG Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: BALTMSG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONTROLLINGOVERHEADMESSAGETP table

ISCONTROLLINGOVERHEADMESSAGE_D-SYSTEMMESSAGETEXT table field - Application Log: Formatted message text ▼ Description: Application Log: Formatted message text Field Name: SYSTEMMESSAGETEXT Data Element: BALTMSG Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: BALTMSG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONTROLLINGOVERHEADMESSAGE_D table

ISCONTROLLINGOVERHEADMESSAG_DR-SYSTEMMESSAGETEXT table field - Application Log: Formatted message text ▼ Description: Application Log: Formatted message text Field Name: SYSTEMMESSAGETEXT Data Element: BALTMSG Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: BALTMSG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONTROLLINGOVERHEADMESSAG_DR table

ISPREPAYMENTPOSTINGMESSAGEST_D-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPREPAYMENTPOSTINGMESSAGEST_D table

ISPREPAYMENTPOSTINGMESSAGES_DR-SYSTEMMESSAGETEXT table field - Message Text ▼ Description: Message Text Field Name: SYSTEMMESSAGETEXT Data Element: BAPI_MSG Data Type: CHAR length (Dec): 220(0) Check table: Conversion Routine: Domain Name: TEXT220 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPREPAYMENTPOSTINGMESSAGES_DR table

ISPUBLICSECTORBRFMESSAGETP2_DR-SYSTEMMESSAGETEXT table field - System Text ▼ Description: System Text Field Name: SYSTEMMESSAGETEXT Data Element: PS_SYSTEM_MSG_TEXT Data Type: SSTR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: SSTRING MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2_DR table

ISRUNSETTLEMENTACTLMESSAGETP_D-SYSTEMMESSAGETEXT table field - Application Log: Formatted message text ▼ Description: Application Log: Formatted message text Field Name: SYSTEMMESSAGETEXT Data Element: BALTMSG Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: BALTMSG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNSETTLEMENTACTLMESSAGETP_D table

ISRUNSETTLEMENTACTLMESSAGET_DR-SYSTEMMESSAGETEXT table field - Application Log: Formatted message text ▼ Description: Application Log: Formatted message text Field Name: SYSTEMMESSAGETEXT Data Element: BALTMSG Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: BALTMSG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNSETTLEMENTACTLMESSAGET_DR table