Details |
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IGRIRINF-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGRIRINF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDMVALMSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMVALMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMFGGMETP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMFGGMETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRFMOFAJM-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMOFAJM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IGRIRPRED-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGRIRPRED table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMFGGMETP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGGMETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PJEAPILOG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: FINCS_MSG_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FINCS_MSG_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PJEAPILOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDMCITMMSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMCITMMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDMVALMSGX-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMVALMSGX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDOCMSGDET-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDOCMSGDET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRFMOFAJMD-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMOFAJMD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRSHOPRVAL-SYSTEMMESSAGETYPE table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEMMESSAGETYPE Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRSHOPRVAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRSHMSGTYP-SYSTEMMESSAGETYPE table field - Single-Character Flag
▼
Description: Single-Character Flag Field Name: SYSTEMMESSAGETYPE Data Element: CHAR1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRSHMSGTYP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PJEAPILOGP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: FINCS_MSG_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FINCS_MSG_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PJEAPILOGP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPMUPDTMSGS-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPMUPDTMSGS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRFMOFAJMSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMOFAJMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPUBSECNOTE-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPUBSECNOTE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDMITMCATMSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMITMCATMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDMVALMSGREC-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMVALMSGREC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDMVALMSGSUM-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMVALMSGSUM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCTRLGOVHDMSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCTRLGOVHDMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPUBSECNOTETP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECNOTETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCOLPROCERRLOG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOLPROCERRLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCOLPROCESSING-SYSTEMMESSAGETYPE table field - Collective Processing Log Status Type
▼
Description: Collective Processing Log Status Type Field Name: SYSTEMMESSAGETYPE Data Element: LE_LOGSTATUS_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: LE_LOGSTATUS_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOLPROCESSING table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPUBSSECNOTETP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPUBSSECNOTETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDMCCLOGITMMSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMCCLOGITMMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIGRIRMONITOR-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGRIRMONITOR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPSMS4CMSGTYPE-SYSTEMMESSAGETYPE table field - Application Log: Message type (A,E,W,I,S)
▼
Description: Application Log: Message type (A,E,W,I,S) Field Name: SYSTEMMESSAGETYPE Data Element: BALMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BALMSGTY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSMS4CMSGTYPE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPUBSECMSGTYPE-SYSTEMMESSAGETYPE table field - System Type
▼
Description: System Type Field Name: SYSTEMMESSAGETYPE Data Element: PS_SYSTEM_MSG_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGTYP_PS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECMSGTYPE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCOUNTMSGTYPES-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCOUNTMSGTYPES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSIMLNDISTMSGS-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIMLNDISTMSGS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICOLLPROCMSGTYP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICOLLPROCMSGTYP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICOUNTPERMSGTYP-SYSTEMMESSAGETYPE table field -
▼
Description: Field Name: SYSTEMMESSAGETYPE Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICOUNTPERMSGTYP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICTRLGOVHDMSGTP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICTRLGOVHDMSGTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPUBSECMSGTYPET-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECMSGTYPET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRVLOGMSGTYPVH-SYSTEMMESSAGETYPE table field -
▼
Description: Field Name: SYSTEMMESSAGETYPE Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVLOGMSGTYPVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PUNIERRWRNGMSGS-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PUNIERRWRNGMSGS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSETTLMNTACTMESG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSETTLMNTACTMESG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICOLLPROCMSGTYPT-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICOLLPROCMSGTYPT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPSMS4CMSGTYPTXT-SYSTEMMESSAGETYPE table field - Application Log: Message type (A,E,W,I,S)
▼
Description: Application Log: Message type (A,E,W,I,S) Field Name: SYSTEMMESSAGETYPE Data Element: BALMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BALMSGTY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSMS4CMSGTYPTXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISETTLMNTACTMESG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISETTLMNTACTMESG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSNOTETP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSNOTETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMDIMPORT-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDIMPORT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPPMGAPMS-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPPMGAPMS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FIMSG_GFN-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FIMSG_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MESSA_GFN-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MESSA_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ADISTRMSGS-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ADISTRMSGS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBDLIF0798-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBDLIF0798 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CBDOCF0797-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBDOCF0797 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCAINV_CFC-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINV_CFC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDISTRMSGS-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDISTRMSGS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMATINVVAP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMATINVVAP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAINV_CFC-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINV_CFC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDISTRMSGS-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDISTRMSGS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MDC_IMPORT-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDC_IMPORT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPRCALCAGE-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRCALCAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSBRFMSGTP-SYSTEMMESSAGETYPE table field - System Type
▼
Description: System Type Field Name: SYSTEMMESSAGETYPE Data Element: PS_SYSTEM_MSG_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGTYP_PS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSBRFMSGTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAINVCFCTP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINVCFCTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMDIMPORTTP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMDIMPORTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMRPMDISSUE-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPMDISSUE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPMGAPMSTP-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMGAPMSTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRACCNOTIF-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCNOTIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSIMLNMSGID-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIMLNMSGID table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCRDTCTRLMSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCRDTCTRLMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRDTVACCMON-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRDTVACCMON table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSIMLNSTSCNT-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSIMLNSTSCNT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CUPDMATINVPR-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CUPDMATINVPR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICRDTCTRLMSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICRDTCTRLMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPMGAPPRMSG-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMGAPPRMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IRFMOFAJMDOC-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMOFAJMDOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRTAXITMLOG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRTAXITMLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MESSA_KK_GFN-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MESSA_KK_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CALLOCNRUNMSG-SYSTEMMESSAGETYPE table field - Message type (E, I, W, ...)
▼
Description: Message type (E, I, W, ...) Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY_CO Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGTY_CO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CALLOCNRUNMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMRPMDISSUETP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMRPMDISSUETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CORDRCONFMSGS-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CORDRCONFMSGS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRCPFINDERISS-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRCPFINDERISS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSRVMPLANSITN-SYSTEMMESSAGETYPE table field -
▼
Description: Field Name: SYSTEMMESSAGETYPE Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVMPLANSITN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFKKINV_CFC_D-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKINV_CFC_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_GRIRPROC-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_GRIRPROC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IALLOCNRUNMSG-SYSTEMMESSAGETYPE table field - Message type (E, I, W, ...)
▼
Description: Message type (E, I, W, ...) Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY_CO Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGTY_CO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IALLOCNRUNMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNSLDINPTMSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: FINCS_MSG_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FINCS_MSG_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNSLDINPTMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNSLDPROCMSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: FINCS_MSG_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FINCS_MSG_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNSLDPROCMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDMCCLOGMCMSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMCCLOGMCMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMRPMDISSUETP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPMDISSUETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IORDRCONFMSGS-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IORDRCONFMSGS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPAYTREQNHIST-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYTREQNHIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPUBSECBRFMSG-SYSTEMMESSAGETYPE table field - System Type
▼
Description: System Type Field Name: SYSTEMMESSAGETYPE Data Element: PS_SYSTEM_MSG_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGTYP_PS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECBRFMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRVMPLANSITN-SYSTEMMESSAGETYPE table field -
▼
Description: Field Name: SYSTEMMESSAGETYPE Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVMPLANSITN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MPEGMETPDRAFT-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPEGMETPDRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PALLOCNRUNMSG-SYSTEMMESSAGETYPE table field - Message type (E, I, W, ...)
▼
Description: Message type (E, I, W, ...) Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY_CO Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGTY_CO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PALLOCNRUNMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PAYREQN_HISTD-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_HISTD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PLGSGLSUCCESS-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLGSGLSUCCESS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WCB_S_MESSAGE-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WCB_S_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WLF_S_MESSAGE-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WLF_S_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIGRIRMONITOR-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIGRIRMONITOR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CFIGRIRPROCESS-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIGRIRPROCESS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRODSPLYITEMD-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRODSPLYITEMD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURGDOCSIMLOG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURGDOCSIMLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURREQREPLMSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQREPLMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FCO_OVHD_MSGDR-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCO_OVHD_MSGDR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_MSG_GFN-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_MSG_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICMDTYFLPKTLOG-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMDTYFLPKTLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDMCCLOGMSGOLD-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMCCLOGMSGOLD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIGRIRHISTORY-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGRIRHISTORY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFIGRIRPROCESS-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGRIRPROCESS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMRPMDISSUEBAS-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPMDISSUEBAS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPGMOVEXCITEM-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPGMOVEXCITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPUBSECNOTEATT-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECNOTEATT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURGDOCSIMLOG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURGDOCSIMLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURREQREPLMSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQREPLMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISGRIRPROCESS1-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGRIRPROCESS1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIGRIRHISTORY-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRHISTORY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIGRIRPROCESS-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRPROCESS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIGRIRPROCSIT-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRPROCSIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIRECNCLNSITN-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIRECNCLNSITN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPH_MRPISS_MAP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPH_MRPISS_MAP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPMGAG_T_MSG_D-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPMGAG_T_MSG_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPRMSGAGEENHCD-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRMSGAGEENHCD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ALLOCCERRORUPLD-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ALLOCCERRORUPLD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCNSLDTNDCTSKLG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: FINCS_MSG_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FINCS_MSG_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNSLDTNDCTSKLG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMFDOF_D_FLMSG-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMFDOF_D_FLMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPUBSECBRFMSGTP-SYSTEMMESSAGETYPE table field - System Type
▼
Description: System Type Field Name: SYSTEMMESSAGETYPE Data Element: PS_SYSTEM_MSG_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGTYP_PS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPUBSECBRFMSGTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSDBILRUNERRLOG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDBILRUNERRLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FCO_SETTLMSG_DR-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCO_SETTLMSG_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKCOLLITEM_GFN-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKCOLLITEM_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAMDDISTRRECDS-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDDISTRRECDS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAMDRECDWTHOBJ-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDRECDWTHOBJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNSLDTNDCTSKLG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: FINCS_MSG_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FINCS_MSG_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNSLDTNDCTSKLG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMIGDATAINSTLOG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMIGDATAINSTLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMIGDATAINSTMSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMIGDATAINSTMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPKANBANCCCERR-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPKANBANCCCERR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPPKANBANCCIERR-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPKANBANCCIERR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPUBSECBRFMSGTP-SYSTEMMESSAGETYPE table field - System Type
▼
Description: System Type Field Name: SYSTEMMESSAGETYPE Data Element: PS_SYSTEM_MSG_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGTYP_PS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECBRFMSGTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PAYREQN_INB_MSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_INB_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIGRIRHISFCHNG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRHISFCHNG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIGRIRHISLCHNG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRHISLCHNG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFIGRIRMONITOR1-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRMONITOR1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPMGAG_T_APPMSG-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPMGAG_T_APPMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ALLOCERRORUPLOAD-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ALLOCERRORUPLOAD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCMDTYFLPKTLOGTP-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMDTYFLPKTLOGTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCNSLDTNRCLTSKLG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: FINCS_MSG_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FINCS_MSG_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNSLDTNRCLTSKLG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPSMS4CPCMTADJTP-SYSTEMMESSAGETYPE table field - Application Log: Message type (A,E,W,I,S)
▼
Description: Application Log: Message type (A,E,W,I,S) Field Name: SYSTEMMESSAGETYPE Data Element: BALMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BALMSGTY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPSMS4CPCMTADJTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINS_GRIRPROCHIS-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_GRIRPROCHIS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICAMDRECDWTHRATG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDRECDWTHRATG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICMDTYFLPKTLOGTP-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMDTYFLPKTLOGTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNSLDTNRCLTSKLG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: FINCS_MSG_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FINCS_MSG_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNSLDTNRCLTSKLG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IDMCCLGITMMSGCAT-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMCCLGITMMSGCAT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IFAILDGMOVEXCITM-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFAILDGMOVEXCITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IILSTRPTAXITMLOG-SYSTEMMESSAGETYPE table field - Message Class
▼
Description: Message Class Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: ARBGB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IILSTRPTAXITMLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPSMS4CPCMTADJTP-SYSTEMMESSAGETYPE table field - Application Log: Message type (A,E,W,I,S)
▼
Description: Application Log: Message type (A,E,W,I,S) Field Name: SYSTEMMESSAGETYPE Data Element: BALMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BALMSGTY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSMS4CPCMTADJTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISDCOLPROCERRLOG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCOLPROCERRLOG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISGRIRPROCESS1_D-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGRIRPROCESS1_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MAINTORDCONFMS_D-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTORDCONFMS_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PAYREQN_STGHISTD-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_STGHISTD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PGRIRHISTPRDCCSR-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PGRIRHISTPRDCCSR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSM_D_PCMTAD_ACT-SYSTEMMESSAGETYPE table field - Application Log: Message type (A,E,W,I,S)
▼
Description: Application Log: Message type (A,E,W,I,S) Field Name: SYSTEMMESSAGETYPE Data Element: BALMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BALMSGTY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSM_D_PCMTAD_ACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VCMMFDOF_D_FLMSG-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VCMMFDOF_D_FLMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VPPMGAG_T_APPMSG-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VPPMGAG_T_APPMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/S4PPM/TS_MESSAGE-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /S4PPM/TS_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MDC_IMPORT_ACTION-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDC_IMPORT_ACTION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PAYREQN_S_MESSAGE-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_S_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PAYREQN_S_PAY_MSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_S_PAY_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIEBDRREQUESTMSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIEBDRREQUESTMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FARR_S_API_MESSAGE-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FARR_S_API_MESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINSS_GRIRPROC_MSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINSS_GRIRPROC_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIXBIT0_MSG_GFN-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXBIT0_MSG_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIXBIT2_MSG_GFN-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXBIT2_MSG_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIXCIT2_MSG_GFN-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXCIT2_MSG_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_BIP_MSG_GFN-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_BIP_MSG_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKINV_CFC_MSG_GFN-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_CFC_MSG_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
JVA_OCF_S_MESSAGES-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP JVA_OCF_S_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMFGGDSMVTEXCPTNTP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGDSMVTEXCPTNTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMASTERDATAIMPORTTP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMASTERDATAIMPORTTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMFGGDSMVTEXCPTNTP_D-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGDSMVTEXCPTNTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPUBLICSECTORNOTETP2-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORNOTETP2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MDC_IMPORT_ATTRIBUTES-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDC_IMPORT_ATTRIBUTES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_DISTRMSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_DISTRMSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCAINVCGCLRFCTNCASETP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAINVCGCLRFCTNCASETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMASTERDATAIMPORTTP_D-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMASTERDATAIMPORTTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMFGGDSMVTEXCPTNTP_DR-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGDSMVTEXCPTNTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PAYREQN_S_REQN_HISTORY-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_S_REQN_HISTORY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SDBIL_EBDR_REQUEST_MSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDBIL_EBDR_REQUEST_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTORDCONFMESSAGETP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDCONFMESSAGETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMRPMASTERDATAISSUETP5-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMRPMASTERDATAISSUETP5 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPUBLICSECTORNOTETP2_D-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORNOTETP2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_PO_FOD_S_MESSAGES-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PO_FOD_S_MESSAGES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINSS_GRIRACCOUNTRCN_ENH-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINSS_GRIRACCOUNTRCN_ENH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCAINVCGCLRFCTNCASETP_D-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAINVCGCLRFCTNCASETP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPUBLICSECTORNOTETP2_DR-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORNOTETP2_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FINSS_GRIRPROC_STATUS_ENH-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINSS_GRIRPROC_STATUS_ENH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCAINVCGCLRFCTNCASETP_DR-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAINVCGCLRFCTNCASETP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTORDCONFMESSAGETP_D-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDCONFMESSAGETP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMRPMASTERDATAISSUETP5_D-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMRPMASTERDATAISSUETP5_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PAYREQN_S_INBOUND_PAY_MSG-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_S_INBOUND_PAY_MSG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FKKBIX_RATING_ITEM_MSG_GFN-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_RATING_ITEM_MSG_GFN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMAINTORDCONFMESSAGETP_DR-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDCONFMESSAGETP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMFGGOODSMOVEMENTEXCPTNTP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGOODSMOVEMENTEXCPTNTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPUBSECPERIODICCMTMTADJTP-SYSTEMMESSAGETYPE table field - Application Log: Message type (A,E,W,I,S)
▼
Description: Application Log: Message type (A,E,W,I,S) Field Name: SYSTEMMESSAGETYPE Data Element: BALMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BALMSGTY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBSECPERIODICCMTMTADJTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPUBLICSECTORBRFMESSAGETP2-SYSTEMMESSAGETYPE table field - System Type
▼
Description: System Type Field Name: SYSTEMMESSAGETYPE Data Element: PS_SYSTEM_MSG_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGTYP_PS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SD_SLS_FDP_ITM_TXT_LINE-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_ITM_TXT_LINE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMFGGOODSMOVEMENTEXCPTNTP_D-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGOODSMOVEMENTEXCPTNTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPUBSECPERIODICCMTMTADJTP_D-SYSTEMMESSAGETYPE table field - Application Log: Message type (A,E,W,I,S)
▼
Description: Application Log: Message type (A,E,W,I,S) Field Name: SYSTEMMESSAGETYPE Data Element: BALMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BALMSGTY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBSECPERIODICCMTMTADJTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRUNSETTLEMENTACTLMESSAGETP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNSETTLEMENTACTLMESSAGETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCOMMODITYORDFILLPACKETLOGTP-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOMMODITYORDFILLPACKETLOGTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISMFGGOODSMOVEMENTEXCPTNTP_DR-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: MSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGAR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGOODSMOVEMENTEXCPTNTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPREPAYMENTPOSTINGMESSAGESTP-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPREPAYMENTPOSTINGMESSAGESTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPUBLICSECTORBRFMESSAGETP2_D-SYSTEMMESSAGETYPE table field - System Type
▼
Description: System Type Field Name: SYSTEMMESSAGETYPE Data Element: PS_SYSTEM_MSG_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGTYP_PS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCOMMODITYORDFILLPACKETLOGT_D-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOMMODITYORDFILLPACKETLOGT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCONTROLLINGOVERHEADMESSAGETP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONTROLLINGOVERHEADMESSAGETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCONTROLLINGOVERHEADMESSAGE_D-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONTROLLINGOVERHEADMESSAGE_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCONTROLLINGOVERHEADMESSAG_DR-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONTROLLINGOVERHEADMESSAG_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISK_CONTROLLINGOVERHEADMESSAGE-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISK_CONTROLLINGOVERHEADMESSAGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISK_RUNSETTLEMENTACTLMESSAGETP-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISK_RUNSETTLEMENTACTLMESSAGETP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPREPAYMENTPOSTINGMESSAGEST_D-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPREPAYMENTPOSTINGMESSAGEST_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPREPAYMENTPOSTINGMESSAGES_DR-SYSTEMMESSAGETYPE table field - Message type: S Success, E Error, W Warning, I Info, A Abort
▼
Description: Message type: S Success, E Error, W Warning, I Info, A Abort Field Name: SYSTEMMESSAGETYPE Data Element: BAPI_MTYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPREPAYMENTPOSTINGMESSAGES_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPUBLICSECTORBRFMESSAGETP2_DR-SYSTEMMESSAGETYPE table field - System Type
▼
Description: System Type Field Name: SYSTEMMESSAGETYPE Data Element: PS_SYSTEM_MSG_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MSGTYP_PS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRUNSETTLEMENTACTLMESSAGETP_D-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNSETTLEMENTACTLMESSAGETP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRUNSETTLEMENTACTLMESSAGET_DR-SYSTEMMESSAGETYPE table field - Message Type
▼
Description: Message Type Field Name: SYSTEMMESSAGETYPE Data Element: SYMSGTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SYCHAR01 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNSETTLEMENTACTLMESSAGET_DR table
|