SAP SYSTEMMESSAGEVARIABLE2 field - Message Variable details in SAP

Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211

Details

CDMVALMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMVALMSG table

CMFGGMETP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable 2 ▼ Description: Message Variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: EHPRC_MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMFGGMETP table

IMFGGMETP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable 2 ▼ Description: Message Variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: EHPRC_MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGGMETP table

PJEAPILOG-SYSTEMMESSAGEVARIABLE2 table field - ▼ Description: Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PJEAPILOG table

CDMCITMMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMCITMMSG table

CDMVALMSGX-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMVALMSGX table

CDOCMSGDET-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDOCMSGDET table

PJEAPILOGP-SYSTEMMESSAGEVARIABLE2 table field - ABAP System Field: Message Variable ▼ Description: ABAP System Field: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYST_MSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PJEAPILOGP table

CPMUPDTMSGS-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPMUPDTMSGS table

PPUBSECNOTE-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPUBSECNOTE table

CDMITMCATMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMITMCATMSG table

CDMVALMSGREC-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMVALMSGREC table

CDMVALMSGSUM-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDMVALMSGSUM table

IPUBSECNOTETP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECNOTETP table

CCOLPROCERRLOG-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOLPROCERRLOG table

CPUBSSECNOTETP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPUBSSECNOTETP table

IDMCCLOGITMMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMCCLOGITMMSG table

IFIGRIRMONITOR-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGRIRMONITOR table

CFLFRITP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFLFRITP table

PSNOTETP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSNOTETP table

CMDIMPORT-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDIMPORT table

CPPMGAPMS-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPPMGAPMS table

FIMSG_GFN-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FIMSG_GFN table

IFL_PR_FR-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFL_PR_FR table

MESSA_GFN-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MESSA_GFN table

ADISTRMSGS-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ADISTRMSGS table

CBDLIF0798-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBDLIF0798 table

CBDOCF0797-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBDOCF0797 table

CCAINV_CFC-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINV_CFC table

CDISTRMSGS-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDISTRMSGS table

CRFMOFAJMD-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMOFAJMD table

ICAINV_CFC-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINV_CFC table

IDISTRMSGS-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDISTRMSGS table

MDC_IMPORT-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDC_IMPORT table

PPRCALCAGE-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRCALCAGE table

PSBRFMSGTP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSBRFMSGTP table

ICAINVCFCTP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINVCFCTP table

IFL_PR_FRTP-SYSTEMMESSAGEVARIABLE2 table field - ▼ Description: Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFL_PR_FRTP table

IMDIMPORTTP-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMDIMPORTTP table

IMRPMDISSUE-SYSTEMMESSAGEVARIABLE2 table field - Message Variable 2 ▼ Description: Message Variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: EHPRC_MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPMDISSUE table

IOUTREQILOG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IOUTREQILOG table

IPPMGAPMSTP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMGAPMSTP table

IPRACCNOTIF-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCNOTIF table

POUTREQILOG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POUTREQILOG table

CCRDTCTRLMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCRDTCTRLMSG table

CPRDTVACCMON-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRDTVACCMON table

CSIMLNSTSCNT-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSIMLNSTSCNT table

ICRDTCTRLMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICRDTCTRLMSG table

IPPMGAPPRMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMGAPPRMSG table

IRFMOFAJMDOC-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMOFAJMDOC table

ISRTAXITMLOG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable 2 ▼ Description: Message Variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRTAXITMLOG table

MESSA_KK_GFN-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MESSA_KK_GFN table

CALLOCNRUNMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CALLOCNRUNMSG table

CMRPMDISSUETP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable 2 ▼ Description: Message Variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: EHPRC_MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMRPMDISSUETP table

CORDRCONFMSGS-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CORDRCONFMSGS table

DFKKINV_CFC_D-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKINV_CFC_D table

FINS_GRIRPROC-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_GRIRPROC table

IALLOCNRUNMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IALLOCNRUNMSG table

ICNSLDINPTMSG-SYSTEMMESSAGEVARIABLE2 table field - ABAP System Field: Message Variable ▼ Description: ABAP System Field: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYST_MSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNSLDINPTMSG table

ICNSLDPROCMSG-SYSTEMMESSAGEVARIABLE2 table field - ABAP System Field: Message Variable ▼ Description: ABAP System Field: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYST_MSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNSLDPROCMSG table

IDMCCLOGMCMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMCCLOGMCMSG table

IFINOCSTAGING-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFINOCSTAGING table

IMRPMDISSUETP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable 2 ▼ Description: Message Variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: EHPRC_MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPMDISSUETP table

IORDRCONFMSGS-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IORDRCONFMSGS table

IPAYTREQNHIST-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYTREQNHIST table

IPUBSECBRFMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECBRFMSG table

MPEGMETPDRAFT-SYSTEMMESSAGEVARIABLE2 table field - Message Variable 2 ▼ Description: Message Variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: EHPRC_MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPEGMETPDRAFT table

PALLOCNRUNMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PALLOCNRUNMSG table

PAYREQN_HISTD-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_HISTD table

PLGSGLSUCCESS-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLGSGLSUCCESS table

CFIGRIRMONITOR-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIGRIRMONITOR table

CFIGRIRPROCESS-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIGRIRPROCESS table

CPRDTVACCSDOBJ-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRDTVACCSDOBJ table

CPRDTVACCSRVOB-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRDTVACCSRVOB table

CPRODSPLYITEMD-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRODSPLYITEMD table

CPURGDOCSIMLOG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURGDOCSIMLOG table

CPURREQREPLMSG-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQREPLMSG table

CRSHMNTSCHDACT-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRSHMNTSCHDACT table

FCO_OVHD_MSGDR-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCO_OVHD_MSGDR table

FKKBIX_MSG_GFN-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_MSG_GFN table

ICMDTYFLPKTLOG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMDTYFLPKTLOG table

IDMCCLOGMSGOLD-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMCCLOGMSGOLD table

IFIGRIRHISTORY-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGRIRHISTORY table

IFIGRIRPROCESS-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGRIRPROCESS table

IMRPMDISSUEBAS-SYSTEMMESSAGEVARIABLE2 table field - Message Variable 2 ▼ Description: Message Variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: EHPRC_MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPMDISSUEBAS table

IPPGMOVEXCITEM-SYSTEMMESSAGEVARIABLE2 table field - Message Variable 2 ▼ Description: Message Variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: EHPRC_MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPGMOVEXCITEM table

IPUBSECNOTEATT-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECNOTEATT table

IPURGDOCSIMLOG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURGDOCSIMLOG table

IPURREQREPLMSG-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQREPLMSG table

IRSHMNTSCHDACT-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRSHMNTSCHDACT table

ISGRIRPROCESS1-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGRIRPROCESS1 table

PFIGRIRHISTORY-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRHISTORY table

PFIGRIRPROCESS-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRPROCESS table

PFIRECNCLNSITN-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIRECNCLNSITN table

PPH_MRPISS_MAP-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPH_MRPISS_MAP table

PPMGAG_T_MSG_D-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPMGAG_T_MSG_D table

PPRMSGAGEENHCD-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRMSGAGEENHCD table

CCNSLDTNDCTSKLG-SYSTEMMESSAGEVARIABLE2 table field - ABAP System Field: Message Variable ▼ Description: ABAP System Field: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYST_MSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNSLDTNDCTSKLG table

CMMFDOF_D_FLMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMFDOF_D_FLMSG table

CMMFDOR_D_BKT_D-SYSTEMMESSAGEVARIABLE2 table field - ▼ Description: Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: Data Type: CHAR length (Dec): 25(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMFDOR_D_BKT_D table

CPUBSECBRFMSGTP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPUBSECBRFMSGTP table

FCO_SETTLMSG_DR-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCO_SETTLMSG_DR table

FKKCOLLITEM_GFN-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKCOLLITEM_GFN table

ICAMDDISTRRECDS-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDDISTRRECDS table

ICAMDRECDWTHOBJ-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDRECDWTHOBJ table

ICMMDTYORDBKTTP-SYSTEMMESSAGEVARIABLE2 table field - ▼ Description: Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: Data Type: CHAR length (Dec): 25(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMDTYORDBKTTP table

ICNSLDTNDCTSKLG-SYSTEMMESSAGEVARIABLE2 table field - ABAP System Field: Message Variable ▼ Description: ABAP System Field: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYST_MSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNSLDTNDCTSKLG table

ICTRLGOVHDMSGTP-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICTRLGOVHDMSGTP table

IMIGDATAINSTLOG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMIGDATAINSTLOG table

IMIGDATAINSTMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMIGDATAINSTMSG table

IPPKANBANCCCERR-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPKANBANCCCERR table

IPPKANBANCCIERR-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPKANBANCCIERR table

IPUBSECBRFMSGTP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECBRFMSGTP table

PAYREQN_INB_MSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_INB_MSG table

PFIGRIRHISFCHNG-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRHISFCHNG table

PFIGRIRHISLCHNG-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGRIRHISLCHNG table

PPMGAG_T_APPMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPMGAG_T_APPMSG table

CCMDTYFLPKTLOGTP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCMDTYFLPKTLOGTP table

CCNSLDTNRCLTSKLG-SYSTEMMESSAGEVARIABLE2 table field - ABAP System Field: Message Variable ▼ Description: ABAP System Field: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYST_MSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNSLDTNRCLTSKLG table

FINS_GRIRPROCHIS-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_GRIRPROCHIS table

IASSTMTMDLGENERR-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IASSTMTMDLGENERR table

ICAMDRECDWTHRATG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDRECDWTHRATG table

ICMDTYFLPKTLOGTP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMDTYFLPKTLOGTP table

ICNSLDTNRCLTSKLG-SYSTEMMESSAGEVARIABLE2 table field - ABAP System Field: Message Variable ▼ Description: ABAP System Field: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYST_MSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNSLDTNRCLTSKLG table

IDMCCLGITMMSGCAT-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMCCLGITMMSGCAT table

IFAILDGMOVEXCITM-SYSTEMMESSAGEVARIABLE2 table field - Message Variable 2 ▼ Description: Message Variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: EHPRC_MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFAILDGMOVEXCITM table

IPSMS4CPCMTADJTP-SYSTEMMESSAGEVARIABLE2 table field - Application Log: Message variable 2 ▼ Description: Application Log: Message variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: BALMSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSMS4CPCMTADJTP table

IRSHMNTSCHDACTTP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRSHMNTSCHDACTTP table

ISDCOLPROCERRLOG-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCOLPROCERRLOG table

ISETTLMNTACTMESG-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISETTLMNTACTMESG table

ISGRIRPROCESS1_D-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGRIRPROCESS1_D table

MAINTORDCONFMS_D-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTORDCONFMS_D table

PAYREQN_STGHISTD-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_STGHISTD table

PSM_D_PCMTAD_ACT-SYSTEMMESSAGEVARIABLE2 table field - Application Log: Message variable 2 ▼ Description: Application Log: Message variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: BALMSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSM_D_PCMTAD_ACT table

VCMMFDOF_D_FLMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VCMMFDOF_D_FLMSG table

VPPMGAG_T_APPMSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VPPMGAG_T_APPMSG table

/S4PPM/TS_MESSAGE-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /S4PPM/TS_MESSAGE table

MDC_IMPORT_ACTION-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDC_IMPORT_ACTION table

PAYREQN_S_MESSAGE-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_S_MESSAGE table

PAYREQN_S_PAY_MSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_S_PAY_MSG table

BAPIEBDRREQUESTMSG-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIEBDRREQUESTMSG table

FARR_S_API_MESSAGE-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FARR_S_API_MESSAGE table

FINSS_GRIRPROC_MSG-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINSS_GRIRPROC_MSG table

FKKBIXBIT0_MSG_GFN-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXBIT0_MSG_GFN table

FKKBIXBIT2_MSG_GFN-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXBIT2_MSG_GFN table

FKKBIXCIT2_MSG_GFN-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIXCIT2_MSG_GFN table

FKKBIX_BIP_MSG_GFN-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_BIP_MSG_GFN table

FKKINV_CFC_MSG_GFN-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_CFC_MSG_GFN table

JVA_OCF_S_MESSAGES-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP JVA_OCF_S_MESSAGES table

ISMFGGDSMVTEXCPTNTP-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGDSMVTEXCPTNTP table

ISMASTERDATAIMPORTTP-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMASTERDATAIMPORTTP table

ISMFGGDSMVTEXCPTNTP_D-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGDSMVTEXCPTNTP_D table

ISPUBLICSECTORNOTETP2-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORNOTETP2 table

MDC_IMPORT_ATTRIBUTES-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDC_IMPORT_ATTRIBUTES table

MMPUR_S_CCTR_DISTRMSG-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_DISTRMSG table

ISCAINVCGCLRFCTNCASETP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAINVCGCLRFCTNCASETP table

ISMASTERDATAIMPORTTP_D-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMASTERDATAIMPORTTP_D table

ISMFGGDSMVTEXCPTNTP_DR-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGDSMVTEXCPTNTP_DR table

PAYREQN_S_REQN_HISTORY-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_S_REQN_HISTORY table

SDBIL_EBDR_REQUEST_MSG-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDBIL_EBDR_REQUEST_MSG table

ISCMMDTYORDREQBRACKETTP-SYSTEMMESSAGEVARIABLE2 table field - ▼ Description: Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: Data Type: CHAR length (Dec): 25(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCMMDTYORDREQBRACKETTP table

ISMAINTORDCONFMESSAGETP-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDCONFMESSAGETP table

ISMRPMASTERDATAISSUETP5-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMRPMASTERDATAISSUETP5 table

ISPUBLICSECTORNOTETP2_D-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORNOTETP2_D table

MMPUR_PO_FOD_S_MESSAGES-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PO_FOD_S_MESSAGES table

FINSS_GRIRACCOUNTRCN_ENH-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINSS_GRIRACCOUNTRCN_ENH table

ISCAINVCGCLRFCTNCASETP_D-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAINVCGCLRFCTNCASETP_D table

ISPUBLICSECTORNOTETP2_DR-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORNOTETP2_DR table

FINSS_GRIRPROC_STATUS_ENH-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINSS_GRIRPROC_STATUS_ENH table

ISCAINVCGCLRFCTNCASETP_DR-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAINVCGCLRFCTNCASETP_DR table

ISCMMDTYORDREQBRACKETTP_D-SYSTEMMESSAGEVARIABLE2 table field - ▼ Description: Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: Data Type: CHAR length (Dec): 25(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCMMDTYORDREQBRACKETTP_D table

ISMAINTORDCONFMESSAGETP_D-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDCONFMESSAGETP_D table

ISMRPMASTERDATAISSUETP5_D-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMRPMASTERDATAISSUETP5_D table

PAYREQN_S_INBOUND_PAY_MSG-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAYREQN_S_INBOUND_PAY_MSG table

FKKBIX_RATING_ITEM_MSG_GFN-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_RATING_ITEM_MSG_GFN table

ISCMMDTYORDREQBRACKETTP_DR-SYSTEMMESSAGEVARIABLE2 table field - ▼ Description: Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: Data Type: CHAR length (Dec): 25(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCMMDTYORDREQBRACKETTP_DR table

ISMAINTORDCONFMESSAGETP_DR-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDCONFMESSAGETP_DR table

ISMFGGOODSMOVEMENTEXCPTNTP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable 2 ▼ Description: Message Variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: EHPRC_MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGOODSMOVEMENTEXCPTNTP table

ISPUBSECPERIODICCMTMTADJTP-SYSTEMMESSAGEVARIABLE2 table field - Application Log: Message variable 2 ▼ Description: Application Log: Message variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: BALMSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBSECPERIODICCMTMTADJTP table

ISPUBLICSECTORBRFMESSAGETP2-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2 table

ISMFGGOODSMOVEMENTEXCPTNTP_D-SYSTEMMESSAGEVARIABLE2 table field - Message Variable 2 ▼ Description: Message Variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: EHPRC_MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGOODSMOVEMENTEXCPTNTP_D table

ISPUBSECPERIODICCMTMTADJTP_D-SYSTEMMESSAGEVARIABLE2 table field - Application Log: Message variable 2 ▼ Description: Application Log: Message variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: BALMSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBSECPERIODICCMTMTADJTP_D table

ISRSHMAINTSCHEDACTIVITYLOGTP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRSHMAINTSCHEDACTIVITYLOGTP table

ISRUNSETTLEMENTACTLMESSAGETP-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNSETTLEMENTACTLMESSAGETP table

ISCOMMODITYORDFILLPACKETLOGTP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOMMODITYORDFILLPACKETLOGTP table

ISMFGGOODSMOVEMENTEXCPTNTP_DR-SYSTEMMESSAGEVARIABLE2 table field - Message Variable 2 ▼ Description: Message Variable 2 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: EHPRC_MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGOODSMOVEMENTEXCPTNTP_DR table

ISPREPAYMENTPOSTINGMESSAGESTP-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPREPAYMENTPOSTINGMESSAGESTP table

ISPUBLICSECTORBRFMESSAGETP2_D-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2_D table

ISCOMMODITYORDFILLPACKETLOGT_D-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOMMODITYORDFILLPACKETLOGT_D table

ISCONTROLLINGOVERHEADMESSAGETP-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONTROLLINGOVERHEADMESSAGETP table

ISCONTROLLINGOVERHEADMESSAGE_D-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONTROLLINGOVERHEADMESSAGE_D table

ISCONTROLLINGOVERHEADMESSAG_DR-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONTROLLINGOVERHEADMESSAG_DR table

ISPREPAYMENTPOSTINGMESSAGEST_D-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPREPAYMENTPOSTINGMESSAGEST_D table

ISPREPAYMENTPOSTINGMESSAGES_DR-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPREPAYMENTPOSTINGMESSAGES_DR table

ISPUBLICSECTORBRFMESSAGETP2_DR-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2_DR table

ISRSHMAINTSCHEDACTIVITYLOGT5_D-SYSTEMMESSAGEVARIABLE2 table field - Message Variable ▼ Description: Message Variable Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: SYMSGV Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: SYCHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRSHMAINTSCHEDACTIVITYLOGT5_D table

ISRUNSETTLEMENTACTLMESSAGETP_D-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNSETTLEMENTACTLMESSAGETP_D table

ISRUNSETTLEMENTACTLMESSAGET_DR-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼ Description: Message variable 02 Field Name: SYSTEMMESSAGEVARIABLE2 Data Element: MSGV2 Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: CHAR50 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNSETTLEMENTACTLMESSAGET_DR table