SAP TIMESLICE field - TIme slice (MS or HH) details in SAP

Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205 Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207 Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208 Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209 Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210 Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211

Details

GMRABL-TIMESLICE table field - GM Timeslice text in the format '010[MM/DD/YYYY-MM/DD/YYYY]' ▼ Description: GM Timeslice text in the format '010[MM/DD/YYYY-MM/DD/YYYY]' Field Name: TIMESLICE Data Element: GM_TIMESLICE_TEXT Data Type: CHAR length (Dec): 26(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GMRABL table

GMRBOL-TIMESLICE table field - GM Timeslice text in the format '010[MM/DD/YYYY-MM/DD/YYYY]' ▼ Description: GM Timeslice text in the format '010[MM/DD/YYYY-MM/DD/YYYY]' Field Name: TIMESLICE Data Element: GM_TIMESLICE_TEXT Data Type: CHAR length (Dec): 26(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GMRBOL table

GMRBOL2-TIMESLICE table field - GM Timeslice text in the format '010[MM/DD/YYYY-MM/DD/YYYY]' ▼ Description: GM Timeslice text in the format '010[MM/DD/YYYY-MM/DD/YYYY]' Field Name: TIMESLICE Data Element: GM_TIMESLICE_TEXT Data Type: CHAR length (Dec): 26(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GMRBOL2 table

MSQ_DBCNFG-TIMESLICE table field - A SQL Server configuration parameter value ▼ Description: A SQL Server configuration parameter value Field Name: TIMESLICE Data Element: MSQCFVALUE Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: INT4 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MSQ_DBCNFG table

/SDF/WS_SHM_KEY-TIMESLICE table field - TIme slice (MS or HH) ▼ Description: TIme slice (MS or HH) Field Name: TIMESLICE Data Element: Data Type: NUMC length (Dec): 2(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SDF/WS_SHM_KEY table

/SCMB/SC_EXTMRESULT-TIMESLICE table field - ▼ Description: Field Name: TIMESLICE Data Element: CL_TIMESLICE Data Type: REF length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/SC_EXTMRESULT table

EEDM_REPLACE_DIALOG-TIMESLICE table field - ▼ Description: Field Name: TIMESLICE Data Element: EEDM_DATE_TIME_FROM_TO Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EEDM_REPLACE_DIALOG table

/SAPAPO/CRES_LC_XTSTREAM-TIMESLICE table field - ▼ Description: Field Name: TIMESLICE Data Element: /SAPAPO/CRES_TLO_SLICE Data Type: TTYP length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/CRES_LC_XTSTREAM table

EEDM_REPLACE_CONSUMP_DATA-TIMESLICE table field - ▼ Description: Field Name: TIMESLICE Data Element: EEDM_DATE_TIME_FROM_TO Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EEDM_REPLACE_CONSUMP_DATA table

EWASORDCREASERVFREQTSCMPL-TIMESLICE table field - ▼ Description: Field Name: TIMESLICE Data Element: EWASORDCREASERVFREQTIMESLICE Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWASORDCREASERVFREQTSCMPL table

/SAPAPO/CRES_XTSTREAM_STRU-TIMESLICE table field - ▼ Description: Field Name: TIMESLICE Data Element: /SAPAPO/CRES_TLO_SLICE Data Type: TTYP length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/CRES_XTSTREAM_STRU table

EWASSERVFREQGROUPTIMESLICE_MAP-TIMESLICE table field - ▼ Description: Field Name: TIMESLICE Data Element: EWASSERVFREQTIMESLICE_KEY Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWASSERVFREQGROUPTIMESLICE_MAP table