Details |
APURGCNDNTYPE-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: T000 Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
APURGCNDNTYPE-CONDITIONUSAGE table field - Usage of the condition table
▼
Description: Usage of the condition table Field Name: CONDITIONUSAGE Data Element: KVEWE Data Type: CHAR length (Dec): 1(0) Check table: T681V Conversion Routine: Domain Name: KVEWE MemoryID: KVW AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONUSAGE
|
APURGCNDNTYPE-CONDITIONAPPLICATION table field - Application
▼
Description: Application Field Name: CONDITIONAPPLICATION Data Element: KAPPL Data Type: CHAR length (Dec): 2(0) Check table: T681Z Conversion Routine: Domain Name: KAPPL MemoryID: KAP AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONAPPLICATION
|
APURGCNDNTYPE-CONDITIONTYPE table field - Condition Type
▼
Description: Condition Type Field Name: CONDITIONTYPE Data Element: KSCHL Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: KSCHL MemoryID: VKS AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONTYPE
|
APURGCNDNTYPE-ACCESSSEQUENCE table field - Access Sequence
▼
Description: Access Sequence Field Name: ACCESSSEQUENCE Data Element: KOZGF Data Type: CHAR length (Dec): 4(0) Check table: T682 Conversion Routine: Domain Name: KOZGF MemoryID: AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACCESSSEQUENCE
|
APURGCNDNTYPE-CONDITIONCALCULATIONTYPE table field - Calculation Type for Condition
▼
Description: Calculation Type for Condition Field Name: CONDITIONCALCULATIONTYPE Data Element: KRECH_LONG Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: KRECH3 MemoryID: AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONCALCULATIONTYPE
|
APURGCNDNTYPE-CONDITIONCATEGORY table field - Condition Category (Examples: Tax, Freight, Price, Cost)
▼
Description: Condition Category (Examples: Tax, Freight, Price, Cost) Field Name: CONDITIONCATEGORY Data Element: KNTYP Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KNTYP MemoryID: AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONCATEGORY
|
APURGCNDNTYPE-CONDITIONCLASS table field - Condition Class
▼
Description: Condition Class Field Name: CONDITIONCLASS Data Element: KOAID Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KOAID MemoryID: AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONCLASS
|
APURGCNDNTYPE-PRCGCNDNAMOUNTROUNDINGRULE table field - Rounding Rule
▼
Description: Rounding Rule Field Name: PRCGCNDNAMOUNTROUNDINGRULE Data Element: TXPRF Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: TXPRF MemoryID: AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRCGCNDNAMOUNTROUNDINGRULE
|
APURGCNDNTYPE-STRUCTURECONDITION table field - Structure Condition
▼
Description: Structure Condition Field Name: STRUCTURECONDITION Data Element: KDUPL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KDUPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STRUCTURECONDITION
|
APURGCNDNTYPE-PRCGCONDITIONAMOUNTSIGN table field - Plus/Minus Sign of the condition Amount
▼
Description: Plus/Minus Sign of the condition Amount Field Name: PRCGCONDITIONAMOUNTSIGN Data Element: KNEGA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KNEGA MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRCGCONDITIONAMOUNTSIGN
|
APURGCNDNTYPE-ISGROUPCONDITION table field - Group Condition
▼
Description: Group Condition Field Name: ISGROUPCONDITION Data Element: KGRPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KGRPE MemoryID: AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISGROUPCONDITION
|
APURGCNDNTYPE-PRCGCNDNRNDNGDIFFSISSETTLED table field - Rounding difference comparison
▼
Description: Rounding difference comparison Field Name: PRCGCNDNRNDNGDIFFSISSETTLED Data Element: RDIFA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRCGCNDNRNDNGDIFFSISSETTLED
|
APURGCNDNTYPE-PRCGGROUPCONDITIONROUTINE table field - Routine Number for Creating Group Key
▼
Description: Routine Number for Creating Group Key Field Name: PRCGGROUPCONDITIONROUTINE Data Element: GRLNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRCGGROUPCONDITIONROUTINE
|
APURGCNDNTYPE-CNDNMANUALENTRIES table field - Making Manual Entries
▼
Description: Making Manual Entries Field Name: CNDNMANUALENTRIES Data Element: KMANU Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KMANU MemoryID: AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNDNMANUALENTRIES
|
APURGCNDNTYPE-CNDNAPPLIESHEADER table field - Condition Applies to Header
▼
Description: Condition Applies to Header Field Name: CNDNAPPLIESHEADER Data Element: KKOPF Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNDNAPPLIESHEADER
|
APURGCNDNTYPE-CNDNAPPLIESITEMS table field - Condition Applies to Items
▼
Description: Condition Applies to Items Field Name: CNDNAPPLIESITEMS Data Element: KPOSI Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNDNAPPLIESITEMS
|
APURGCNDNTYPE-PRCGCNDNTYPEDELETIONISALLOWED table field - Delete the Scope for Changing Amount/Percentage
▼
Description: Delete the Scope for Changing Amount/Percentage Field Name: PRCGCNDNTYPEDELETIONISALLOWED Data Element: KAEND_LOE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRCGCNDNTYPEDELETIONISALLOWED
|
APURGCNDNTYPE-PRCGCNDNAMOUNTCHANGEDISALLOWED table field - Change of Condition Amount/Percentage
▼
Description: Change of Condition Amount/Percentage Field Name: PRCGCNDNAMOUNTCHANGEDISALLOWED Data Element: KAEND_BTR Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRCGCNDNAMOUNTCHANGEDISALLOWED
|
APURGCNDNTYPE-PRCGCNDNCNVRSNFCTRCHGISALLOWED table field - Scope for Changing Conversion Factors
▼
Description: Scope for Changing Conversion Factors Field Name: PRCGCNDNCNVRSNFCTRCHGISALLOWED Data Element: KAEND_UFK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRCGCNDNCNVRSNFCTRCHGISALLOWED
|
APURGCNDNTYPE-PRCGCNDNVALCHGISALLWD table field - Scope for Changing the Value
▼
Description: Scope for Changing the Value Field Name: PRCGCNDNVALCHGISALLWD Data Element: KAEND_WRT Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRCGCNDNVALCHGISALLWD
|
APURGCNDNTYPE-PRCGCNDNPRPSDVALIDFROMDATECODE table field - Proposed Start Date for the Validity Period
▼
Description: Proposed Start Date for the Validity Period Field Name: PRCGCNDNPRPSDVALIDFROMDATECODE Data Element: DTVOB Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: DTVOB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRCGCNDNPRPSDVALIDFROMDATECODE
|
APURGCNDNTYPE-PRCGCNDNPRPSDVALIDTODATECODE table field - Proposed End Date for the Validity Period
▼
Description: Proposed End Date for the Validity Period Field Name: PRCGCNDNPRPSDVALIDTODATECODE Data Element: DATVO Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: DATVO MemoryID: AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRCGCNDNPRPSDVALIDTODATECODE
|
APURGCNDNTYPE-PRICINGPROCEDURE table field - Pricing Procedure in Pricing
▼
Description: Pricing Procedure in Pricing Field Name: PRICINGPROCEDURE Data Element: KALSMASD Data Type: CHAR length (Dec): 6(0) Check table: T683 Conversion Routine: Domain Name: KALSM MemoryID: AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRICINGPROCEDURE
|
APURGCNDNTYPE-PRCGCONDITIONDELETIONMETHOD table field - Condition records should be deleted from the database
▼
Description: Condition records should be deleted from the database Field Name: PRCGCONDITIONDELETIONMETHOD Data Element: KDELE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KDELE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRCGCONDITIONDELETIONMETHOD
|
APURGCNDNTYPE-PRICINGSCALEBASISSHORT table field - Scale Base Type
▼
Description: Scale Base Type Field Name: PRICINGSCALEBASISSHORT Data Element: KZBZG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KZBZG MemoryID: AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRICINGSCALEBASISSHORT
|
APURGCNDNTYPE-PRICINGSCALECHECKINGRULE table field - Checking Rule for Scale Amounts
▼
Description: Checking Rule for Scale Amounts Field Name: PRICINGSCALECHECKINGRULE Data Element: KSTPR Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KSTPR MemoryID: AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRICINGSCALECHECKINGRULE
|
APURGCNDNTYPE-PRICINGSCALETYPE table field - Scale Type
▼
Description: Scale Type Field Name: PRICINGSCALETYPE Data Element: STFKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: STFKZ MemoryID: AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRICINGSCALETYPE
|
APURGCNDNTYPE-PRICINGSCALEROUTINE table field - Routine for Alternative Calculation of Scale Base Value
▼
Description: Routine for Alternative Calculation of Scale Base Value Field Name: PRICINGSCALEROUTINE Data Element: KOFRS Data Type: NUMC length (Dec): 7(0) Check table: Conversion Routine: Domain Name: KOFRM_LONG MemoryID: AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRICINGSCALEROUTINE
|
APURGCNDNTYPE-PRICINGSCALEUNIT table field - Scale Unit
▼
Description: Scale Unit Field Name: PRICINGSCALEUNIT Data Element: GRMEN Data Type: UNIT length (Dec): 3(0) Check table: T006 Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field PRICINGSCALEUNIT
|
APURGCNDNTYPE-PRCGCNDNCRCYCNVRSNISAFTMLTPL table field - Indicator: Currency Translation after Multiplication
▼
Description: Indicator: Currency Translation after Multiplication Field Name: PRCGCNDNCRCYCNVRSNISAFTMLTPL Data Element: GANZZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRCGCNDNCRCYCNVRSNISAFTMLTPL
|
APURGCNDNTYPE-ISRELEVANTFORACCRUAL table field - Condition is Relevant for Accrual (e.g. Freight)
▼
Description: Condition is Relevant for Accrual (e.g. Freight) Field Name: ISRELEVANTFORACCRUAL Data Element: KRUEK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISRELEVANTFORACCRUAL
|
APURGCNDNTYPE-CNDNISFORVARIANTCONFIGURATION table field - Condition Used for Variant Configuration
▼
Description: Condition Used for Variant Configuration Field Name: CNDNISFORVARIANTCONFIGURATION Data Element: KVARC Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNDNISFORVARIANTCONFIGURATION
|
APURGCNDNTYPE-PRCGCNDNQTYCNVRSNISACTIVATED table field - Quantity Conversion
▼
Description: Quantity Conversion Field Name: PRCGCNDNQTYCNVRSNISACTIVATED Data Element: KMENG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRCGCNDNQTYCNVRSNISACTIVATED
|
APURGCNDNTYPE-CNDNISRELEVANTFORINTCOBILLING table field - Condition for Intercompany Billing
▼
Description: Condition for Intercompany Billing Field Name: CNDNISRELEVANTFORINTCOBILLING Data Element: KFKIV Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNDNISRELEVANTFORINTCOBILLING
|
APURGCNDNTYPE-CONDITIONEXCLUSION table field - Condition exclusion indicator
▼
Description: Condition exclusion indicator Field Name: CONDITIONEXCLUSION Data Element: KZNEP Data Type: CHAR length (Dec): 1(0) Check table: T686A Conversion Routine: Domain Name: KZNEP MemoryID: AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONEXCLUSION
|
APURGCNDNTYPE-CNDNVALUEZEROPROCGCODE table field - Process Conditions with Value Equal to Zero
▼
Description: Process Conditions with Value Equal to Zero Field Name: CNDNVALUEZEROPROCGCODE Data Element: VAL_ZERO Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: VAL_ZERO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNDNVALUEZEROPROCGCODE
|
APURGCNDNTYPE-ISRELEVANTFORSALESPRICECALC table field - Sales Price Calculation: Relevant to Pricing
▼
Description: Sales Price Calculation: Relevant to Pricing Field Name: ISRELEVANTFORSALESPRICECALC Data Element: VKKAL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISRELEVANTFORSALESPRICECALC
|