SAP BANKACCLIMWD table - I_BANKACCOUNTTP I_BANKACCLIMITTP details in SAP
SAP BANKACCLIMWD table summary
Warning: Undefined array key "id" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 101Object Name: BANKACCLIMWD
Dictionary Type: Transparent table
Description: I_BANKACCOUNTTP I_BANKACCLIMITTP
Field list for BANKACCLIMWD table on an S/4 SAP system
Details |
BANKACCLIMWD-MANDT table field - Client ▼Description: Client |
BANKACCLIMWD-DRAFTUUID table field - UUID serving as key (parent key, root key) ▼Description: UUID serving as key (parent key, root key) |
BANKACCLIMWD-PARENTDRAFTUUID table field - UUID serving as key (parent key, root key) ▼Description: UUID serving as key (parent key, root key) |
BANKACCLIMWD-BANKACCOUNTINTERNALID table field - Bank Account Technical ID ▼Description: Bank Account Technical ID |
BANKACCLIMWD-OVERDRAFTLIMIT table field - Overdraft Limit ID ▼Description: Overdraft Limit ID |
BANKACCLIMWD-BANKACCOUNTREVISION table field - Revision Number ▼Description: Revision Number |
BANKACCLIMWD-OVERDRAFTLIMITFOREDIT table field - Overdraft Limit ID ▼Description: Overdraft Limit ID |
BANKACCLIMWD-OVERDRAFTLIMITSTARTDATE table field - Overdraft Limit: Valid From ▼Description: Overdraft Limit: Valid From |
BANKACCLIMWD-OVERDRAFTLIMITENDDATE table field - Overdraft Limit: Valid To ▼Description: Overdraft Limit: Valid To |
BANKACCLIMWD-OVERDRAFTLIMITAMOUNT table field - Overdraft Limit Amount ▼Description: Overdraft Limit Amount |
BANKACCLIMWD-OVERDRAFTLIMITCURRENCY table field - Currency Key ▼Description: Currency Key |
BANKACCLIMWD-ISMARKEDFORDELETION table field - Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') ▼Description: Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') |
BANKACCLIMWD-HASACTIVEENTITY table field - Draft - Indicator - Has active document ▼Description: Draft - Indicator - Has active document |
BANKACCLIMWD-DRAFTENTITYCREATIONDATETIME table field - Draft Created On ▼Description: Draft Created On |
BANKACCLIMWD-DRAFTENTITYLASTCHANGEDATETIME table field - Draft Last Changed On ▼Description: Draft Last Changed On |
BANKACCLIMWD-DRAFTADMINISTRATIVEDATAUUID table field - Technical ID for the Administrative Data of a Draft Document ▼Description: Technical ID for the Administrative Data of a Draft Document |
BANKACCLIMWD-DRAFTENTITYCONSISTENCYSTATUS table field - Draft - Consistency Status ▼Description: Draft - Consistency Status |
BANKACCLIMWD-DRAFTENTITYOPERATIONCODE table field - Draft - Operation Code ▼Description: Draft - Operation Code |
Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 234 Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 278 Warning: Undefined variable $obj1 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj2 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj3 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj4 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj5 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj6 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj7 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj8 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj9 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj10 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj11 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
View list of all SAP tables(S4H/ECC)
Select data from SAP table