SAP CCCCRRSDSRELASSM table - Generated Table for View details in SAP
SAP CCCCRRSDSRELASSM table summary
Warning: Undefined array key "id" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 101Object Name: CCCCRRSDSRELASSM
Dictionary Type: Table view
Description: Generated Table for View
Field list for CCCCRRSDSRELASSM table on an S/4 SAP system
Details |
CCCCRRSDSRELASSM-MANDT table field - Client ▼Description: Client |
CCCCRRSDSRELASSM-CHMLCMPLNCINFOUUID table field - Chemical Compliance Information ▼Description: Chemical Compliance Information |
CCCCRRSDSRELASSM-CMPLRQVERSUUID table field - Compliance Requirement UUID ▼Description: Compliance Requirement UUID |
CCCCRRSDSRELASSM-CMPLRQRSLTUUID table field - Compliance Assessment UUID ▼Description: Compliance Assessment UUID |
CCCCRRSDSRELASSM-CMPLRQVERSNAME table field - Compliance Requirement Name ▼Description: Compliance Requirement Name |
CCCCRRSDSRELASSM-CMPLRQVERSNAMEINCURLANG table field - Compliance Requirement Name ▼Description: Compliance Requirement Name |
CCCCRRSDSRELASSM-CMPLRQVERSENGLISHNAME table field - Compliance Requirement Name ▼Description: Compliance Requirement Name |
CCCCRRSDSRELASSM-COMPLIANCEREQUIREMENT table field - Compliance Requirement ▼Description: Compliance Requirement |
CCCCRRSDSRELASSM-CMPLRQPATTERN table field - ▼Description: |
CCCCRRSDSRELASSM-CMPLRQRSLTNAVGNLINK table field - Compliance Assessment UUID ▼Description: Compliance Assessment UUID |
CCCCRRSDSRELASSM-CMPLRQRSLTPROCESSINGSTATUS table field - Processing Status of a Compliance Requirement ▼Description: Processing Status of a Compliance Requirement |
CCCCRRSDSRELASSM-PROCESSOR table field - Processor ▼Description: Processor |
CCCCRRSDSRELASSM-CMPLRQRSLTPRELIMPROCESSORNAME table field - Processor/Released By ▼Description: Processor/Released By |
CCCCRRSDSRELASSM-RELEASEDBYUSER table field - Released By ▼Description: Released By |
CCCCRRSDSRELASSM-RELEASEDBYUSERNAME table field - Processor/Released By ▼Description: Processor/Released By |
CCCCRRSDSRELASSM-CMPLRQRSLTPROCESSORNAME table field - Processor/Released By ▼Description: Processor/Released By |
CCCCRRSDSRELASSM-HASDRAFTENTITY table field - Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') ▼Description: Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') |
CCCCRRSDSRELASSM-ISACTIVEENTITY table field - Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') ▼Description: Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') |
Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 234 Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 278 Warning: Undefined variable $obj1 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj2 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj3 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj4 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj5 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj6 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj7 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj8 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj9 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj10 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj11 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
View list of all SAP tables(S4H/ECC)
Select data from SAP table