Details |
CLEORDIDLPRFQRY-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: T000 Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
CLEORDIDLPRFQRY-ORDERDOCUMENT table field - Sales Order
▼
Description: Sales Order Field Name: ORDERDOCUMENT Data Element: VDM_ORDER Data Type: CHAR length (Dec): 10(0) Check table: VBAK Conversion Routine: ALPHA Domain Name: VBELN MemoryID: AUN AppClass: V SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field ORDERDOCUMENT
|
CLEORDIDLPRFQRY-ORDERDOCUMENTITEM table field - Order Item
▼
Description: Order Item Field Name: ORDERDOCUMENTITEM Data Element: INCOMING_ORDER_ITEM Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: POSNR MemoryID: AppClass: V SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDERDOCUMENTITEM
|
CLEORDIDLPRFQRY-ORDERDOCUMENTITEMINTERNALID table field -
▼
Description: Field Name: ORDERDOCUMENTITEMINTERNALID Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDERDOCUMENTITEMINTERNALID
|
CLEORDIDLPRFQRY-SALESORDER table field - Sales Order
▼
Description: Sales Order Field Name: SALESORDER Data Element: VDM_SALES_ORDER Data Type: CHAR length (Dec): 10(0) Check table: VBAK Conversion Routine: ALPHA Domain Name: VBELN MemoryID: AUN AppClass: V SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field SALESORDER
|
CLEORDIDLPRFQRY-STOCKTRANSPORTORDER table field - Stock Transport Order / Purchase Order
▼
Description: Stock Transport Order / Purchase Order Field Name: STOCKTRANSPORTORDER Data Element: VDM_STO_PURCHASE_ORDER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: EBELN MemoryID: AppClass: ME SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field STOCKTRANSPORTORDER
|
CLEORDIDLPRFQRY-DOCUMENTCATEGORY table field - Order Document Category
▼
Description: Order Document Category Field Name: DOCUMENTCATEGORY Data Element: ORDERDOCUMENTCATEGORY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCUMENTCATEGORY
|
CLEORDIDLPRFQRY-DELIVERYPRIORITY table field - Delivery Priority
▼
Description: Delivery Priority Field Name: DELIVERYPRIORITY Data Element: LPRIO Data Type: NUMC length (Dec): 2(0) Check table: TPRIO Conversion Routine: Domain Name: LPRIO MemoryID: AppClass: V SHLP: SHLP Field: ConvExit: See all SAP tables containing field DELIVERYPRIORITY
|
CLEORDIDLPRFQRY-DELIVERYTYPE table field - Delivery Type
▼
Description: Delivery Type Field Name: DELIVERYTYPE Data Element: LFART Data Type: CHAR length (Dec): 4(0) Check table: TVLK Conversion Routine: Domain Name: LFART MemoryID: ALT AppClass: VL SHLP: SHLP Field: ConvExit: See all SAP tables containing field DELIVERYTYPE
|
CLEORDIDLPRFQRY-SHIPPINGCONDITION table field - Shipping Conditions
▼
Description: Shipping Conditions Field Name: SHIPPINGCONDITION Data Element: VSBED Data Type: CHAR length (Dec): 2(0) Check table: TVSB Conversion Routine: Domain Name: VSBED MemoryID: AppClass: VV SHLP: SHLP Field: ConvExit: See all SAP tables containing field SHIPPINGCONDITION
|
CLEORDIDLPRFQRY-SHIPPINGPOINT table field - Shipping Point / Receiving Point
▼
Description: Shipping Point / Receiving Point Field Name: SHIPPINGPOINT Data Element: VSTEL Data Type: CHAR length (Dec): 4(0) Check table: TVST Conversion Routine: Domain Name: VSTEL MemoryID: VST AppClass: VV SHLP: SHLP Field: ConvExit: See all SAP tables containing field SHIPPINGPOINT
|
CLEORDIDLPRFQRY-TRANSPORTATIONGROUP table field - Transportation Group
▼
Description: Transportation Group Field Name: TRANSPORTATIONGROUP Data Element: TRAGR Data Type: CHAR length (Dec): 4(0) Check table: TTGR Conversion Routine: Domain Name: TRAGR MemoryID: AppClass: VV SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRANSPORTATIONGROUP
|
CLEORDIDLPRFQRY-WAREHOUSENUMBER table field - Warehouse Number / Warehouse Complex
▼
Description: Warehouse Number / Warehouse Complex Field Name: WAREHOUSENUMBER Data Element: LGNUM Data Type: CHAR length (Dec): 3(0) Check table: T300 Conversion Routine: Domain Name: LGNUM MemoryID: LGN AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field WAREHOUSENUMBER
|
CLEORDIDLPRFQRY-DISTRIBUTIONCHANNEL table field - Distribution Channel
▼
Description: Distribution Channel Field Name: DISTRIBUTIONCHANNEL Data Element: VTWEG Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: VTWEG MemoryID: VTW AppClass: MG SHLP: C_VTWEG SHLP Field: VTWEG ConvExit: See all SAP tables containing field DISTRIBUTIONCHANNEL
|
CLEORDIDLPRFQRY-DIVISION table field - Division
▼
Description: Division Field Name: DIVISION Data Element: SPART Data Type: CHAR length (Dec): 2(0) Check table: TSPA Conversion Routine: Domain Name: SPART MemoryID: SPA AppClass: V SHLP: C_SPART SHLP Field: SPART ConvExit: See all SAP tables containing field DIVISION
|
CLEORDIDLPRFQRY-CURRENCY table field - Display Currency
▼
Description: Display Currency Field Name: CURRENCY Data Element: VDM_V_DISPLAY_CURRENCY Data Type: CUKY length (Dec): 5(0) Check table: Conversion Routine: Domain Name: WAERS MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field CURRENCY
|
CLEORDIDLPRFQRY-DOCUMENTCURRENCY table field - SD Document Currency
▼
Description: SD Document Currency Field Name: DOCUMENTCURRENCY Data Element: WAERK Data Type: CUKY length (Dec): 5(0) Check table: TCURC Conversion Routine: Domain Name: WAERS MemoryID: FWS AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCUMENTCURRENCY
|
CLEORDIDLPRFQRY-EXCHANGERATETYPE table field - Exchange Rate Type
▼
Description: Exchange Rate Type Field Name: EXCHANGERATETYPE Data Element: KURST Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: KURST MemoryID: KUT AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXCHANGERATETYPE
|
CLEORDIDLPRFQRY-RATIOUNIT table field - Base Unit of Measure
▼
Description: Base Unit of Measure Field Name: RATIOUNIT Data Element: MEINS Data Type: UNIT length (Dec): 3(0) Check table: Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field RATIOUNIT
|
CLEORDIDLPRFQRY-TRANSPORDDELAYUNIT table field - Base Unit of Measure
▼
Description: Base Unit of Measure Field Name: TRANSPORDDELAYUNIT Data Element: MEINS Data Type: UNIT length (Dec): 3(0) Check table: Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field TRANSPORDDELAYUNIT
|
CLEORDIDLPRFQRY-FORWARDINGAGENT table field - Forwarding Agent
▼
Description: Forwarding Agent Field Name: FORWARDINGAGENT Data Element: SPDNR Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: LIFNR MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field FORWARDINGAGENT
|
CLEORDIDLPRFQRY-INCOTERMSCLASSIFICATION table field - Incoterms (Part 1)
▼
Description: Incoterms (Part 1) Field Name: INCOTERMSCLASSIFICATION Data Element: INCO1 Data Type: CHAR length (Dec): 3(0) Check table: TINC Conversion Routine: Domain Name: INCO1 MemoryID: AppClass: V SHLP: SHLP Field: ConvExit: See all SAP tables containing field INCOTERMSCLASSIFICATION
|
CLEORDIDLPRFQRY-MATERIALGROUP table field - Material Group
▼
Description: Material Group Field Name: MATERIALGROUP Data Element: MATKL Data Type: CHAR length (Dec): 9(0) Check table: T023 Conversion Routine: Domain Name: MATKL MemoryID: MKL AppClass: MG SHLP: S_WBWG SHLP Field: MATKL ConvExit: See all SAP tables containing field MATERIALGROUP
|
CLEORDIDLPRFQRY-MATERIAL table field - Material Number
▼
Description: Material Number Field Name: MATERIAL Data Element: MATNR Data Type: CHAR length (Dec): 40(0) Check table: MARA Conversion Routine: MATN1 Domain Name: MATNR MemoryID: MAT AppClass: MG SHLP: S_MAT1 SHLP Field: MATNR ConvExit: MATN1 See all SAP tables containing field MATERIAL
|
CLEORDIDLPRFQRY-SALESORDERTYPE table field - Order Document Type
▼
Description: Order Document Type Field Name: SALESORDERTYPE Data Element: ORDERDOCUMENTTYPE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: AUART Domain Name: AUART MemoryID: AppClass: VA SHLP: SHLP Field: ConvExit: AUART See all SAP tables containing field SALESORDERTYPE
|
CLEORDIDLPRFQRY-SALESDOCUMENTTYPENAME table field - Order Document Type Text
▼
Description: Order Document Type Text Field Name: SALESDOCUMENTTYPENAME Data Element: ORDERDOCUMENTTYPENAME Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: TEXT20 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESDOCUMENTTYPENAME
|
CLEORDIDLPRFQRY-PURCHASINGGROUP table field - Purchasing Group
▼
Description: Purchasing Group Field Name: PURCHASINGGROUP Data Element: BKGRP Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: EKGRP MemoryID: EKG AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGGROUP
|
CLEORDIDLPRFQRY-PURCHASINGORGANIZATION table field - Purchasing organization
▼
Description: Purchasing organization Field Name: PURCHASINGORGANIZATION Data Element: EKORG Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: EKORG MemoryID: EKO AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGORGANIZATION
|
CLEORDIDLPRFQRY-ROUTE table field - Route
▼
Description: Route Field Name: ROUTE Data Element: ROUTE Data Type: CHAR length (Dec): 6(0) Check table: TVRO Conversion Routine: Domain Name: ROUTE MemoryID: AppClass: VV SHLP: SHLP Field: ConvExit: See all SAP tables containing field ROUTE
|
CLEORDIDLPRFQRY-SALESOFFICE table field - Sales office
▼
Description: Sales office Field Name: SALESOFFICE Data Element: VKBUR Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: VKBUR MemoryID: VKB AppClass: V SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESOFFICE
|
CLEORDIDLPRFQRY-SALESORGANIZATION table field - Sales Organization
▼
Description: Sales Organization Field Name: SALESORGANIZATION Data Element: VKORG Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: VKORG MemoryID: VKO AppClass: MG SHLP: C_VKORG SHLP Field: VKORG ConvExit: See all SAP tables containing field SALESORGANIZATION
|
CLEORDIDLPRFQRY-SHIPTOPARTY table field - Ship-to Party
▼
Description: Ship-to Party Field Name: SHIPTOPARTY Data Element: KUNWE Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: KUNNR MemoryID: AppClass: V SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field SHIPTOPARTY
|
CLEORDIDLPRFQRY-SOLDTOPARTY table field - Sold-to Party
▼
Description: Sold-to Party Field Name: SOLDTOPARTY Data Element: KUNAG Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: KUNNR MemoryID: VAG AppClass: V SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field SOLDTOPARTY
|
CLEORDIDLPRFQRY-SOLDTOPARTYCLASSIFICATION table field - Customer Classification
▼
Description: Customer Classification Field Name: SOLDTOPARTYCLASSIFICATION Data Element: ORDER_CUSTOMER_CLASSIFICATION Data Type: CHAR length (Dec): 2(0) Check table: TKUKL Conversion Routine: Domain Name: KUKLA MemoryID: AppClass: VP SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOLDTOPARTYCLASSIFICATION
|
CLEORDIDLPRFQRY-PLANT table field - Plant
▼
Description: Plant Field Name: PLANT Data Element: WERKS_D Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field PLANT
|
CLEORDIDLPRFQRY-RECEIVINGPLANT table field - Receiving Plant for Deliveries
▼
Description: Receiving Plant for Deliveries Field Name: RECEIVINGPLANT Data Element: EMPFW Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: WERKS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field RECEIVINGPLANT
|
CLEORDIDLPRFQRY-EARLIESTREQDDELIVDATE table field - Requested Delivery Date of Earliest Scheduled Delivery
▼
Description: Requested Delivery Date of Earliest Scheduled Delivery Field Name: EARLIESTREQDDELIVDATE Data Element: EARLIEST_REQD_DELIV_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field EARLIESTREQDDELIVDATE
|
CLEORDIDLPRFQRY-EARLIESTPLNDGIDATE table field - Planned Goods Issue Date of Earliest Scheduled Delivery
▼
Description: Planned Goods Issue Date of Earliest Scheduled Delivery Field Name: EARLIESTPLNDGIDATE Data Element: EARLIEST_PLND_GI_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field EARLIESTPLNDGIDATE
|
CLEORDIDLPRFQRY-REQDDELIVDATEYEAR table field - Calendar Year
▼
Description: Calendar Year Field Name: REQDDELIVDATEYEAR Data Element: CALENDARYEAR Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: Domain Name: NUM4 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQDDELIVDATEYEAR
|
CLEORDIDLPRFQRY-REQDDELIVDATEYEARQUARTER table field - Year Quarter
▼
Description: Year Quarter Field Name: REQDDELIVDATEYEARQUARTER Data Element: VDM_YEARQUARTER Data Type: NUMC length (Dec): 5(0) Check table: Conversion Routine: Domain Name: NUM5 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQDDELIVDATEYEARQUARTER
|
CLEORDIDLPRFQRY-REQDDELIVDATEYEARMONTH table field - Year Month
▼
Description: Year Month Field Name: REQDDELIVDATEYEARMONTH Data Element: VDM_YEARMONTH Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: NUM6 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQDDELIVDATEYEARMONTH
|
CLEORDIDLPRFQRY-REQDDELIVDATECALENDARMONTH table field - Calendar Month
▼
Description: Calendar Month Field Name: REQDDELIVDATECALENDARMONTH Data Element: CALENDARMONTH Data Type: NUMC length (Dec): 2(0) Check table: Conversion Routine: Domain Name: NUM2 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQDDELIVDATECALENDARMONTH
|
CLEORDIDLPRFQRY-REQDDELIVDATEYEARWEEK table field - Year Week
▼
Description: Year Week Field Name: REQDDELIVDATEYEARWEEK Data Element: VDM_YEARWEEK Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: NUM6 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQDDELIVDATEYEARWEEK
|
CLEORDIDLPRFQRY-PLNDGIDATEYEAR table field - Year of Planned Goods Issue Date
▼
Description: Year of Planned Goods Issue Date Field Name: PLNDGIDATEYEAR Data Element: PLND_GI_DATE_YEAR Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: Domain Name: NUM4 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLNDGIDATEYEAR
|
CLEORDIDLPRFQRY-PLNDGIDATEYEARQUARTER table field - Quarter of Planned Goods Issue Date
▼
Description: Quarter of Planned Goods Issue Date Field Name: PLNDGIDATEYEARQUARTER Data Element: PLND_GI_DATE_YEAR_QUARTER Data Type: NUMC length (Dec): 5(0) Check table: Conversion Routine: Domain Name: NUM5 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLNDGIDATEYEARQUARTER
|
CLEORDIDLPRFQRY-PLNDGIDATEYEARWEEK table field - Week of Planned Goods Issue Date
▼
Description: Week of Planned Goods Issue Date Field Name: PLNDGIDATEYEARWEEK Data Element: PLND_GI_DATE_YEAR_WEEK Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: NUM6 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLNDGIDATEYEARWEEK
|
CLEORDIDLPRFQRY-ORDDOCITMDELIVFLFMTSTS table field - Processing Status of Sales Order Item Delivery Fulfillment
▼
Description: Processing Status of Sales Order Item Delivery Fulfillment Field Name: ORDDOCITMDELIVFLFMTSTS Data Element: SLS_ORD_ITM_DELIV_FLFMT_STS Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SLS_ORD_DELIV_FLFMT_STS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDDOCITMDELIVFLFMTSTS
|
CLEORDIDLPRFQRY-NMBROFDLVRDASREQDORDERITEMS table field - Number of Sales Order Items Delivered as Requested
▼
Description: Number of Sales Order Items Delivered as Requested Field Name: NMBROFDLVRDASREQDORDERITEMS Data Element: NROF_DLVRD_AS_REQD_SO_ITEMS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFDLVRDASREQDORDERITEMS
|
CLEORDIDLPRFQRY-NMBROFSHIPPEDASPLANNEDORDITEMS table field - Number of Sales Order Items Shipped as Planned
▼
Description: Number of Sales Order Items Shipped as Planned Field Name: NMBROFSHIPPEDASPLANNEDORDITEMS Data Element: NROF_SHIPPED_AS_PLND_SO_ITEMS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFSHIPPEDASPLANNEDORDITEMS
|
CLEORDIDLPRFQRY-NUMBEROFINCOMINGORDERITEMS table field - Number of Incoming Sales Order Items
▼
Description: Number of Incoming Sales Order Items Field Name: NUMBEROFINCOMINGORDERITEMS Data Element: NMBR_OF_INCG_SLS_ORD_ITEMS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFINCOMINGORDERITEMS
|
CLEORDIDLPRFQRY-INCOMINGORDERNETAMOUNT table field - Incoming Orders Net Value
▼
Description: Incoming Orders Net Value Field Name: INCOMINGORDERNETAMOUNT Data Element: INCG_ORDS_NET_AMT Data Type: CURR length (Dec): 19(2) Check table: Conversion Routine: Domain Name: WERTV10 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field INCOMINGORDERNETAMOUNT
|
CLEORDIDLPRFQRY-INCOMINGORDERSNETAMTINDC table field - Incoming Orders Net Value In Display Currency
▼
Description: Incoming Orders Net Value In Display Currency Field Name: INCOMINGORDERSNETAMTINDC Data Element: INCG_ORDS_NET_AMT_IN_DC Data Type: CURR length (Dec): 19(2) Check table: Conversion Routine: Domain Name: WERTV10 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field INCOMINGORDERSNETAMTINDC
|
CLEORDIDLPRFQRY-DLVRDASREQDORDERITMNETAMT table field - Items delivered as requested value in transaction currency
▼
Description: Items delivered as requested value in transaction currency Field Name: DLVRDASREQDORDERITMNETAMT Data Element: DLVRD_AS_REQD_ORDER_NETAMT Data Type: CURR length (Dec): 19(2) Check table: Conversion Routine: Domain Name: WERTV10 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field DLVRDASREQDORDERITMNETAMT
|
CLEORDIDLPRFQRY-DLVRDASREQDORDERITMNETAMTINDC table field - Items delivered as requested value in display currency
▼
Description: Items delivered as requested value in display currency Field Name: DLVRDASREQDORDERITMNETAMTINDC Data Element: DLVRD_AS_REQD_ORD_NETAMT_IN_DC Data Type: CURR length (Dec): 19(2) Check table: Conversion Routine: Domain Name: WERTV10 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field DLVRDASREQDORDERITMNETAMTINDC
|
CLEORDIDLPRFQRY-SHPDASPLNDORDERITMNETAMT table field - Items shipped as planned value in transaction currency
▼
Description: Items shipped as planned value in transaction currency Field Name: SHPDASPLNDORDERITMNETAMT Data Element: SHPD_AS_PLND_ORD_ITM_NETAMT Data Type: CURR length (Dec): 19(2) Check table: Conversion Routine: Domain Name: WERTV10 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field SHPDASPLNDORDERITMNETAMT
|
CLEORDIDLPRFQRY-SHPDASPLNDORDERITMNETAMTINDC table field - Items shipped as planned value in display currency
▼
Description: Items shipped as planned value in display currency Field Name: SHPDASPLNDORDERITMNETAMTINDC Data Element: SHPD_AS_PLND_ORD_NETAMT_IN_DC Data Type: CURR length (Dec): 19(2) Check table: Conversion Routine: Domain Name: WERTV10 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field SHPDASPLNDORDERITMNETAMTINDC
|
CLEORDIDLPRFQRY-DELIVTOREQDDELIVDELAYINDAYS table field - Delay of Delivery Compared to Requested Deliv. Date (Days)
▼
Description: Delay of Delivery Compared to Requested Deliv. Date (Days) Field Name: DELIVTOREQDDELIVDELAYINDAYS Data Element: DELIV_TO_REQD_DELIV_DELAY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DELIVTOREQDDELIVDELAYINDAYS
|
CLEORDIDLPRFQRY-MAXDELIVTOREQDDELIVDELAYINDAYS table field - Max. Delay of Deliv. Compared to the Reqd Deliv. Date (Days)
▼
Description: Max. Delay of Deliv. Compared to the Reqd Deliv. Date (Days) Field Name: MAXDELIVTOREQDDELIVDELAYINDAYS Data Element: MAX_DELIV_TO_REQD_DELIV_DELAY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAXDELIVTOREQDDELIVDELAYINDAYS
|
CLEORDIDLPRFQRY-TOTDELIVTOREQDDELIVDELAYINDAYS table field - Tot. Delay of Deliv. Compared to the Reqd Deliv. Date (Days)
▼
Description: Tot. Delay of Deliv. Compared to the Reqd Deliv. Date (Days) Field Name: TOTDELIVTOREQDDELIVDELAYINDAYS Data Element: TOT_DELIV_TO_REQD_DELIV_DELAY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TOTDELIVTOREQDDELIVDELAYINDAYS
|
CLEORDIDLPRFQRY-AVGDELIVTOREQDDELIVDELAYINDAYS table field - Average Delivery Performance as Days of Delay
▼
Description: Average Delivery Performance as Days of Delay Field Name: AVGDELIVTOREQDDELIVDELAYINDAYS Data Element: AVG_DELIV_TO_REQD_DELIV_DELAY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AVGDELIVTOREQDDELIVDELAYINDAYS
|
CLEORDIDLPRFQRY-GITOPLNDGIDELAYINDAYS table field - Delay of Goods Issue Compared to the Planned GI Date (Days)
▼
Description: Delay of Goods Issue Compared to the Planned GI Date (Days) Field Name: GITOPLNDGIDELAYINDAYS Data Element: GI_TO_PLND_GI_DELAY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GITOPLNDGIDELAYINDAYS
|
CLEORDIDLPRFQRY-MAXGITOPLNDGIDELAYINDAYS table field - Max. Delay of GI Compared to the Planned GI Date (Days)
▼
Description: Max. Delay of GI Compared to the Planned GI Date (Days) Field Name: MAXGITOPLNDGIDELAYINDAYS Data Element: MAX_GI_TO_PLND_GI_DELAY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAXGITOPLNDGIDELAYINDAYS
|
CLEORDIDLPRFQRY-TOTGITOPLNDGIDELAYINDAYS table field - Tot. Delay of GI Compared to the Planned GI Date (Days)
▼
Description: Tot. Delay of GI Compared to the Planned GI Date (Days) Field Name: TOTGITOPLNDGIDELAYINDAYS Data Element: TOT_GI_TO_PLND_GI_DELAY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TOTGITOPLNDGIDELAYINDAYS
|
CLEORDIDLPRFQRY-AVGGITOPLNDGIDELAYINDAYS table field - Average Goods Issue Performance as Days of Delay
▼
Description: Average Goods Issue Performance as Days of Delay Field Name: AVGGITOPLNDGIDELAYINDAYS Data Element: AVG_GI_TO_PLND_GI_DELAY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AVGGITOPLNDGIDELAYINDAYS
|
CLEORDIDLPRFQRY-ORDERITEMSDLVRDASREQDRATIO table field - Ratio of order items delivered as requested
▼
Description: Ratio of order items delivered as requested Field Name: ORDERITEMSDLVRDASREQDRATIO Data Element: ORD_ITMS_DLVRD_AS_REQD_RATIO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDERITEMSDLVRDASREQDRATIO
|
CLEORDIDLPRFQRY-ORDERITEMSSHIPPEDASPLNDRATIO table field - Ratio of sales order items shipped as planned
▼
Description: Ratio of sales order items shipped as planned Field Name: ORDERITEMSSHIPPEDASPLNDRATIO Data Element: ORD_ITMS_SHIPPED_AS_PLND_RATIO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDERITEMSSHIPPEDASPLNDRATIO
|
CLEORDIDLPRFQRY-DLVRDASREQDRATIOCURYEAR table field - Ratio of order items delivered as requested (current year)
▼
Description: Ratio of order items delivered as requested (current year) Field Name: DLVRDASREQDRATIOCURYEAR Data Element: ORD_ITMS_DLVRD_AS_REQD_RATIO_Y Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DLVRDASREQDRATIOCURYEAR
|
CLEORDIDLPRFQRY-DLVRDASREQDRATIOCURQUARTER table field - Ratio of order items delivered as requested (cur quarter)
▼
Description: Ratio of order items delivered as requested (cur quarter) Field Name: DLVRDASREQDRATIOCURQUARTER Data Element: ORD_ITMS_DLVRD_AS_REQD_RATIO_Q Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DLVRDASREQDRATIOCURQUARTER
|
CLEORDIDLPRFQRY-DLVRDASREQDRATIOCURMONTH table field - Ratio of order items delivered as requested (current month)
▼
Description: Ratio of order items delivered as requested (current month) Field Name: DLVRDASREQDRATIOCURMONTH Data Element: ORD_ITMS_DLVRD_AS_REQD_RATIO_M Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DLVRDASREQDRATIOCURMONTH
|
CLEORDIDLPRFQRY-DLVRDASREQDRATIOCURWEEK table field - Ratio of order items delivered as requested (current Week)
▼
Description: Ratio of order items delivered as requested (current Week) Field Name: DLVRDASREQDRATIOCURWEEK Data Element: ORD_ITMS_DLVRD_AS_REQD_RATIO_W Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DLVRDASREQDRATIOCURWEEK
|