SAP CMDQPRDPLTDETAIL table - Generated Table for View details in SAP
SAP CMDQPRDPLTDETAIL table summary
Warning: Undefined array key "id" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 101Object Name: CMDQPRDPLTDETAIL
Dictionary Type: Table view
Description: Generated Table for View
Field list for CMDQPRDPLTDETAIL table on an S/4 SAP system
Details |
CMDQPRDPLTDETAIL-MANDT table field - Client ▼Description: Client |
CMDQPRDPLTDETAIL-PRODUCT table field - Material Number ▼Description: Material Number |
CMDQPRDPLTDETAIL-PLANT table field - Plant ▼Description: Plant |
CMDQPRDPLTDETAIL-CONFIGURABLEPRODUCT table field - Configurable material ▼Description: Configurable material |
CMDQPRDPLTDETAIL-PROFILECODE table field - Plant-Specific Material Status ▼Description: Plant-Specific Material Status |
CMDQPRDPLTDETAIL-PROFILEVALIDITYSTARTDATE table field - Date from Which the Plant-Specific Material Status Is Valid ▼Description: Date from Which the Plant-Specific Material Status Is Valid |
CMDQPRDPLTDETAIL-PERIODTYPE table field - Period Indicator ▼Description: Period Indicator |
CMDQPRDPLTDETAIL-FISCALYEARVARIANT table field - Fiscal Year Variant ▼Description: Fiscal Year Variant |
CMDQPRDPLTDETAIL-ISMARKEDFORDELETION table field - Flag Material for Deletion at Plant Level ▼Description: Flag Material for Deletion at Plant Level |
CMDQPRDPLTDETAIL-PLANTCATEGORY table field - Plant category ▼Description: Plant category |
CMDQPRDPLTDETAIL-FISCALMONTHCURRENTPERIOD table field - Current period (posting period) ▼Description: Current period (posting period) |
CMDQPRDPLTDETAIL-FISCALYEARCURRENTPERIOD table field - Fiscal Year of Current Period ▼Description: Fiscal Year of Current Period |
CMDQPRDPLTDETAIL-GOODSISSUEUNIT table field - Unit of issue ▼Description: Unit of issue |
CMDQPRDPLTDETAIL-PRODUCTCFOPCATEGORY table field - Material CFOP category ▼Description: Material CFOP category |
CMDQPRDPLTDETAIL-CONTROLLINGAREA table field - Controlling Area ▼Description: Controlling Area |
CMDQPRDPLTDETAIL-ISBATCHMANAGEMENTREQUIRED table field - Batch Management Requirement Indicator for Plant ▼Description: Batch Management Requirement Indicator for Plant |
CMDQPRDPLTDETAIL-SERIALNUMBERPROFILE table field - Serial Number Profile ▼Description: Serial Number Profile |
CMDQPRDPLTDETAIL-ISNEGATIVESTOCKALLOWED table field - Negative stocks allowed in plant ▼Description: Negative stocks allowed in plant |
CMDQPRDPLTDETAIL-ISVARIANTCONFIGURATIONENABLED table field - Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') ▼Description: Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') |
CMDQPRDPLTDETAIL-AUTHORIZATIONGROUP table field - Authorization Group ▼Description: Authorization Group |
CMDQPRDPLTDETAIL-PRODUCTGROUP table field - Product Group ▼Description: Product Group |
CMDQPRDPLTDETAIL-PRODUCTTYPE table field - Product Type ▼Description: Product Type |
CMDQPRDPLTDETAIL-MRPRESPONSIBLE table field - MRP Controller ▼Description: MRP Controller |
CMDQPRDPLTDETAIL-MRPCONTROLLERNAME table field - MRP Controller Name ▼Description: MRP Controller Name |
CMDQPRDPLTDETAIL-COMMODITY table field - Commodity Code ▼Description: Commodity Code |
CMDQPRDPLTDETAIL-COUNTRYOFORIGIN table field - Country/Region of Origin of Material (Non-Preferential Ori.) ▼Description: Country/Region of Origin of Material (Non-Preferential Ori.) |
CMDQPRDPLTDETAIL-PRODUCTIONSUPERVISOR table field - Production Supervisor ▼Description: Production Supervisor |
CMDQPRDPLTDETAIL-COSTINGLOTSIZE table field - Lot Size for Product Costing ▼Description: Lot Size for Product Costing |
CMDQPRDPLTDETAIL-COSTINGSPECIALPROCUREMENTTYPE table field - Special Procurement Type for Costing ▼Description: Special Procurement Type for Costing |
Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 234 Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 278 Warning: Undefined variable $obj1 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj2 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj3 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj4 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj5 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj6 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj7 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj8 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj9 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj10 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj11 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
View list of all SAP tables(S4H/ECC)
Select data from SAP table