SAP CPURREQREPLMSG table - Generated Table for View details in SAP
SAP CPURREQREPLMSG table summary
Warning: Undefined array key "id" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 101Object Name: CPURREQREPLMSG
Dictionary Type: Table view
Description: Generated Table for View
Field list for CPURREQREPLMSG table on an S/4 SAP system
Details |
CPURREQREPLMSG-MANDT table field - Client ▼Description: Client |
CPURREQREPLMSG-PURCHASEREQUISITION table field - Purchase Requisition Number ▼Description: Purchase Requisition Number |
CPURREQREPLMSG-PURREQNMESSAGESEQUENCENUMBER table field - Sequence number of message during PR replication ▼Description: Sequence number of message during PR replication |
CPURREQREPLMSG-PURREQNEXTERNALSYSTEMID table field - Connected System ID ▼Description: Connected System ID |
CPURREQREPLMSG-PURCHASEREQUISITIONITEM table field - Item number of purchase requisition ▼Description: Item number of purchase requisition |
CPURREQREPLMSG-SYSTEMMESSAGETYPE table field - Message Type ▼Description: Message Type |
CPURREQREPLMSG-SYSTEMMESSAGEIDENTIFICATION table field - Message identification ▼Description: Message identification |
CPURREQREPLMSG-SYSTEMMESSAGENUMBER table field - Message number ▼Description: Message number |
CPURREQREPLMSG-SYSTEMMESSAGEVARIABLE1 table field - Message variable 01 ▼Description: Message variable 01 |
CPURREQREPLMSG-SYSTEMMESSAGEVARIABLE2 table field - Message variable 02 ▼Description: Message variable 02 |
CPURREQREPLMSG-SYSTEMMESSAGEVARIABLE3 table field - Message variable 03 ▼Description: Message variable 03 |
CPURREQREPLMSG-SYSTEMMESSAGEVARIABLE4 table field - Message variable 04 ▼Description: Message variable 04 |
CPURREQREPLMSG-SYSTEMMESSAGETEXT table field - Message Text ▼Description: Message Text |
Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 234 Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 278 Warning: Undefined variable $obj1 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj2 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj3 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj4 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj5 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj6 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj7 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj8 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj9 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj10 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj11 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
View list of all SAP tables(S4H/ECC)
Select data from SAP table