CQLTYTSKDEFCATVF-CREATEDBYUSER table field - Name of Person Responsible for Creating the Object ▼
Description: Name of Person Responsible for Creating the Object Field Name: CREATEDBYUSER Data Element: ERNAM Data Type: CHAR length (Dec): 12(0) Check table: Conversion Routine: Domain Name: USNAM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit:
CQLTYTSKDEFCATVF-CREATIONDATE table field - Date on which the record was created ▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit:
CQLTYTSKDEFCATVF-LASTCHANGEDBYUSER table field - Name of Person Who Changed Object ▼
Description: Name of Person Who Changed Object Field Name: LASTCHANGEDBYUSER Data Element: AENAM Data Type: CHAR length (Dec): 12(0) Check table: Conversion Routine: Domain Name: USNAM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit:
CQLTYTSKDEFCATVF-LASTCHANGEDATE table field - Last Changed On ▼
Description: Last Changed On Field Name: LASTCHANGEDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit:
Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 234
Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 278
Warning: Undefined variable $obj1 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj2 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj3 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj4 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj5 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj6 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj7 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj8 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj9 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj10 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj11 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279