Details |
CSUBCTRG-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: T000 Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
CSUBCTRG-SUPLRMATLPLNT table field -
▼
Description: Field Name: SUPLRMATLPLNT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPLRMATLPLNT
|
CSUBCTRG-PRODPLNTSUPPLIERCONCATENATEDID table field -
▼
Description: Field Name: PRODPLNTSUPPLIERCONCATENATEDID Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODPLNTSUPPLIERCONCATENATEDID
|
CSUBCTRG-MATERIAL table field - BOM component
▼
Description: BOM component Field Name: MATERIAL Data Element: IDNRK Data Type: CHAR length (Dec): 40(0) Check table: MARA Conversion Routine: MATN1 Domain Name: MATNR MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: MATN1 See all SAP tables containing field MATERIAL
|
CSUBCTRG-MATLFILTERANLYTLMOD table field - BOM component
▼
Description: BOM component Field Name: MATLFILTERANLYTLMOD Data Element: IDNRK Data Type: CHAR length (Dec): 40(0) Check table: MARA Conversion Routine: MATN1 Domain Name: MATNR MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: MATN1 See all SAP tables containing field MATLFILTERANLYTLMOD
|
CSUBCTRG-PLANT table field - Plant
▼
Description: Plant Field Name: PLANT Data Element: WERKS_D Data Type: CHAR length (Dec): 4(0) Check table: T001W Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field PLANT
|
CSUBCTRG-PLNTFILTERANLYTLMOD table field - Plant
▼
Description: Plant Field Name: PLNTFILTERANLYTLMOD Data Element: WERKS_D Data Type: CHAR length (Dec): 4(0) Check table: T001W Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field PLNTFILTERANLYTLMOD
|
CSUBCTRG-SUPPLIER table field - Account Number of Supplier
▼
Description: Account Number of Supplier Field Name: SUPPLIER Data Element: LIFNR Data Type: CHAR length (Dec): 10(0) Check table: LFA1 Conversion Routine: ALPHA Domain Name: LIFNR MemoryID: LIF AppClass: FB SHLP: KRED_C SHLP Field: LIFNR ConvExit: ALPHA See all SAP tables containing field SUPPLIER
|
CSUBCTRG-SUPLRFILTERANLYTLMOD table field - Account Number of Supplier
▼
Description: Account Number of Supplier Field Name: SUPLRFILTERANLYTLMOD Data Element: LIFNR Data Type: CHAR length (Dec): 10(0) Check table: LFA1 Conversion Routine: ALPHA Domain Name: LIFNR MemoryID: LIF AppClass: FB SHLP: KRED_C SHLP Field: LIFNR ConvExit: ALPHA See all SAP tables containing field SUPLRFILTERANLYTLMOD
|
CSUBCTRG-PARENTNODE table field -
▼
Description: Field Name: PARENTNODE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PARENTNODE
|
CSUBCTRG-HIERARCHYNODELEVEL table field -
▼
Description: Field Name: HIERARCHYNODELEVEL Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field HIERARCHYNODELEVEL
|
CSUBCTRG-PURCHASINGDOCUMENT table field - Purchase Order Number
▼
Description: Purchase Order Number Field Name: PURCHASINGDOCUMENT Data Element: VDM_PURCHASEORDER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: EBELN MemoryID: BES AppClass: ME SHLP: MEKK_C SHLP Field: EBELN ConvExit: ALPHA See all SAP tables containing field PURCHASINGDOCUMENT
|
CSUBCTRG-PURORDFILTERANLYTLMOD table field - Purchase Order Number
▼
Description: Purchase Order Number Field Name: PURORDFILTERANLYTLMOD Data Element: VDM_PURCHASEORDER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: EBELN MemoryID: BES AppClass: ME SHLP: MEKK_C SHLP Field: EBELN ConvExit: ALPHA See all SAP tables containing field PURORDFILTERANLYTLMOD
|
CSUBCTRG-PURCHASINGDOCUMENTITEM table field -
▼
Description: Field Name: PURCHASINGDOCUMENTITEM Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGDOCUMENTITEM
|
CSUBCTRG-FORMATTEDPURCHASEORDERITEM table field -
▼
Description: Field Name: FORMATTEDPURCHASEORDERITEM Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FORMATTEDPURCHASEORDERITEM
|
CSUBCTRG-REQUESTEDDELIVERYDATE table field - Shipping Date
▼
Description: Shipping Date Field Name: REQUESTEDDELIVERYDATE Data Element: VDM_SHIPPINGDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQUESTEDDELIVERYDATE
|
CSUBCTRG-REQDDELIVDTEFILTERANLYTLMOD table field - Shipping Date
▼
Description: Shipping Date Field Name: REQDDELIVDTEFILTERANLYTLMOD Data Element: VDM_SHIPPINGDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQDDELIVDTEFILTERANLYTLMOD
|
CSUBCTRG-SHIPPINGSTATUS table field - Shipping Status
▼
Description: Shipping Status Field Name: SHIPPINGSTATUS Data Element: VDM_SHIPPINGSTATUS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SHIPPINGSTATUS
|
CSUBCTRG-SHIPGSTSFILTERANLYTLMOD table field - Shipping Status
▼
Description: Shipping Status Field Name: SHIPGSTSFILTERANLYTLMOD Data Element: VDM_SHIPPINGSTATUS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SHIPGSTSFILTERANLYTLMOD
|
CSUBCTRG-ASSEMBLY table field - Assembly
▼
Description: Assembly Field Name: ASSEMBLY Data Element: BAGRP Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: MATN1 Domain Name: MATNR MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: MATN1 See all SAP tables containing field ASSEMBLY
|
CSUBCTRG-ASSEMBLYFILTERANLYTLMOD table field - Assembly
▼
Description: Assembly Field Name: ASSEMBLYFILTERANLYTLMOD Data Element: BAGRP Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: MATN1 Domain Name: MATNR MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: MATN1 See all SAP tables containing field ASSEMBLYFILTERANLYTLMOD
|
CSUBCTRG-PURCHASINGGROUP table field - Purchasing Group
▼
Description: Purchasing Group Field Name: PURCHASINGGROUP Data Element: MMPUR_REQ_D_EKGRP Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: EKGRP MemoryID: EKG AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGGROUP
|
CSUBCTRG-PURGGRPFILTERANLYTLMOD table field - Purchasing Group
▼
Description: Purchasing Group Field Name: PURGGRPFILTERANLYTLMOD Data Element: MMPUR_REQ_D_EKGRP Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: EKGRP MemoryID: EKG AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURGGRPFILTERANLYTLMOD
|
CSUBCTRG-PURCHASINGORGANIZATION table field - Purchasing Organization
▼
Description: Purchasing Organization Field Name: PURCHASINGORGANIZATION Data Element: EKORG_LL Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: EKORG MemoryID: EKO AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGORGANIZATION
|
CSUBCTRG-PURGORGFILTERANLYTLMOD table field - Purchasing Organization
▼
Description: Purchasing Organization Field Name: PURGORGFILTERANLYTLMOD Data Element: EKORG_LL Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: EKORG MemoryID: EKO AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURGORGFILTERANLYTLMOD
|
CSUBCTRG-BATCH table field - Batch Number
▼
Description: Batch Number Field Name: BATCH Data Element: CHARG_D Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: CHARG MemoryID: CHA AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field BATCH
|
CSUBCTRG-BATCHFILTERANLYTLMOD table field - Batch Number
▼
Description: Batch Number Field Name: BATCHFILTERANLYTLMOD Data Element: CHARG_D Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: CHARG MemoryID: CHA AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field BATCHFILTERANLYTLMOD
|
CSUBCTRG-SUPPLYINGPLANT table field - Supply Plant
▼
Description: Supply Plant Field Name: SUPPLYINGPLANT Data Element: VDM_SUPPLYPLANT Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: WERKS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPPLYINGPLANT
|
CSUBCTRG-MATERIALGROUP table field - Material Group
▼
Description: Material Group Field Name: MATERIALGROUP Data Element: MATKL Data Type: CHAR length (Dec): 9(0) Check table: T023 Conversion Routine: Domain Name: MATKL MemoryID: MKL AppClass: MG SHLP: S_WBWG SHLP Field: MATKL ConvExit: See all SAP tables containing field MATERIALGROUP
|
CSUBCTRG-MATLGRPFILTERANLYTLMOD table field - Material Group
▼
Description: Material Group Field Name: MATLGRPFILTERANLYTLMOD Data Element: MATKL Data Type: CHAR length (Dec): 9(0) Check table: T023 Conversion Routine: Domain Name: MATKL MemoryID: MKL AppClass: MG SHLP: S_WBWG SHLP Field: MATKL ConvExit: See all SAP tables containing field MATLGRPFILTERANLYTLMOD
|
CSUBCTRG-STORAGELOCATION table field - Storage Location
▼
Description: Storage Location Field Name: STORAGELOCATION Data Element: PPH_LGORT Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: LGORT MemoryID: LAG AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field STORAGELOCATION
|
CSUBCTRG-SUBCONTRGORDSNODESTORLOCATION table field - Storage Location
▼
Description: Storage Location Field Name: SUBCONTRGORDSNODESTORLOCATION Data Element: PPH_LGORT Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: LGORT MemoryID: LAG AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUBCONTRGORDSNODESTORLOCATION
|
CSUBCTRG-STILLTOBEDELIVEREDQUANTITY table field -
▼
Description: Field Name: STILLTOBEDELIVEREDQUANTITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STILLTOBEDELIVEREDQUANTITY
|
CSUBCTRG-PURCHASEORDERQUANTITYUNIT table field - Base Unit of Measure
▼
Description: Base Unit of Measure Field Name: PURCHASEORDERQUANTITYUNIT Data Element: MEINS Data Type: UNIT length (Dec): 3(0) Check table: Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field PURCHASEORDERQUANTITYUNIT
|
CSUBCTRG-STOCKBALANCEQUANTITYUNIT table field -
▼
Description: Field Name: STOCKBALANCEQUANTITYUNIT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STOCKBALANCEQUANTITYUNIT
|
CSUBCTRG-STOCKUNIT table field -
▼
Description: Field Name: STOCKUNIT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STOCKUNIT
|
CSUBCTRG-DELIVERYTYPE table field - Delivery Type for Materials Provided to Subcontractor
▼
Description: Delivery Type for Materials Provided to Subcontractor Field Name: DELIVERYTYPE Data Element: LBLFA Data Type: CHAR length (Dec): 4(0) Check table: TVLK Conversion Routine: Domain Name: LFART MemoryID: AppClass: VL SHLP: SHLP Field: ConvExit: See all SAP tables containing field DELIVERYTYPE
|
CSUBCTRG-SUBCONTRGORDSNODEDELIVERYTYPE table field - Delivery Type for Materials Provided to Subcontractor
▼
Description: Delivery Type for Materials Provided to Subcontractor Field Name: SUBCONTRGORDSNODEDELIVERYTYPE Data Element: LBLFA Data Type: CHAR length (Dec): 4(0) Check table: TVLK Conversion Routine: Domain Name: LFART MemoryID: AppClass: VL SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUBCONTRGORDSNODEDELIVERYTYPE
|
CSUBCTRG-PROPOSEDSHIPPINGPOINT table field - Proposed Shipping Point
▼
Description: Proposed Shipping Point Field Name: PROPOSEDSHIPPINGPOINT Data Element: VSTED Data Type: CHAR length (Dec): 4(0) Check table: TVSWZ Conversion Routine: Domain Name: VSTEL MemoryID: AppClass: VV SHLP: SHLP Field: ConvExit: See all SAP tables containing field PROPOSEDSHIPPINGPOINT
|
CSUBCTRG-SUBCONTRGORDSNODEPRPSDSHIPGPT table field - Proposed Shipping Point
▼
Description: Proposed Shipping Point Field Name: SUBCONTRGORDSNODEPRPSDSHIPGPT Data Element: VSTED Data Type: CHAR length (Dec): 4(0) Check table: TVSWZ Conversion Routine: Domain Name: VSTEL MemoryID: AppClass: VV SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUBCONTRGORDSNODEPRPSDSHIPGPT
|
CSUBCTRG-SCHEDULELINEDELIVERYDATE table field - Item delivery date
▼
Description: Item delivery date Field Name: SCHEDULELINEDELIVERYDATE Data Element: EINDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field SCHEDULELINEDELIVERYDATE
|
CSUBCTRG-SUBCONTRGDELIVERYDATE table field - Item delivery date
▼
Description: Item delivery date Field Name: SUBCONTRGDELIVERYDATE Data Element: EINDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUBCONTRGDELIVERYDATE
|
CSUBCTRG-NUMBEROFITEMS table field -
▼
Description: Field Name: NUMBEROFITEMS Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFITEMS
|
CSUBCTRG-LOADINGGROUP table field - Loading Group
▼
Description: Loading Group Field Name: LOADINGGROUP Data Element: LADGR Data Type: CHAR length (Dec): 4(0) Check table: TLGR Conversion Routine: Domain Name: LADGR MemoryID: AppClass: VV SHLP: SHLP Field: ConvExit: See all SAP tables containing field LOADINGGROUP
|
CSUBCTRG-SUBCONTRGORDSNODELOADINGGROUP table field - Loading Group
▼
Description: Loading Group Field Name: SUBCONTRGORDSNODELOADINGGROUP Data Element: LADGR Data Type: CHAR length (Dec): 4(0) Check table: TLGR Conversion Routine: Domain Name: LADGR MemoryID: AppClass: VV SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUBCONTRGORDSNODELOADINGGROUP
|
CSUBCTRG-PURCHASINGDOCUMENTTYPE table field - Purchasing Document Category
▼
Description: Purchasing Document Category Field Name: PURCHASINGDOCUMENTTYPE Data Element: BSTYP Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BSTYP MemoryID: AppClass: ME SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGDOCUMENTTYPE
|
CSUBCTRG-PURGDOCTYPEFILTERANLYTLMOD table field - Purchasing Document Category
▼
Description: Purchasing Document Category Field Name: PURGDOCTYPEFILTERANLYTLMOD Data Element: BSTYP Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BSTYP MemoryID: AppClass: ME SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURGDOCTYPEFILTERANLYTLMOD
|
CSUBCTRG-REQUIREDQUANTITY table field -
▼
Description: Field Name: REQUIREDQUANTITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQUIREDQUANTITY
|
CSUBCTRG-MATERIALCOMPONENTNAME table field - Material Description
▼
Description: Material Description Field Name: MATERIALCOMPONENTNAME Data Element: MAKTX Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: TEXT40 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALCOMPONENTNAME
|
CSUBCTRG-PLANTNAME table field - Plant Name
▼
Description: Plant Name Field Name: PLANTNAME Data Element: WERKS_NAME Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: TEXT30 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANTNAME
|
CSUBCTRG-SUPPLIERNAME table field - Name of Supplier
▼
Description: Name of Supplier Field Name: SUPPLIERNAME Data Element: MD_SUPPLIER_NAME Data Type: CHAR length (Dec): 80(0) Check table: Conversion Routine: Domain Name: TEXT80 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPPLIERNAME
|
CSUBCTRG-ASSEMBLYNAME table field - Material Description
▼
Description: Material Description Field Name: ASSEMBLYNAME Data Element: MAKTX Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: TEXT40 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field ASSEMBLYNAME
|
CSUBCTRG-MATERIALGROUPNAME table field - Product Group Description
▼
Description: Product Group Description Field Name: MATERIALGROUPNAME Data Element: PRODUCTGROUPDESCRIPTION Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: TEXT20 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALGROUPNAME
|
CSUBCTRG-STORAGELOCATIONNAME table field - Storage Location Name
▼
Description: Storage Location Name Field Name: STORAGELOCATIONNAME Data Element: LGORT_NAME Data Type: CHAR length (Dec): 16(0) Check table: Conversion Routine: Domain Name: TEXT16 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field STORAGELOCATIONNAME
|
CSUBCTRG-SUPPLYINGPLANTNAME table field - Plant Name
▼
Description: Plant Name Field Name: SUPPLYINGPLANTNAME Data Element: WERKS_NAME Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: TEXT30 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPPLYINGPLANTNAME
|
CSUBCTRG-SHIPPINGSTATUSTEXT table field -
▼
Description: Field Name: SHIPPINGSTATUSTEXT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SHIPPINGSTATUSTEXT
|
CSUBCTRG-PURCHASINGGROUPNAME table field - Purchasing Group Name
▼
Description: Purchasing Group Name Field Name: PURCHASINGGROUPNAME Data Element: MM_A_PURG_GRP_NAME Data Type: CHAR length (Dec): 18(0) Check table: Conversion Routine: Domain Name: TEXT18 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGGROUPNAME
|
CSUBCTRG-PURCHASINGORGANIZATIONNAME table field - Purchasing Organization Name
▼
Description: Purchasing Organization Name Field Name: PURCHASINGORGANIZATIONNAME Data Element: MM_A_PURG_ORG_NAME Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: TEXT20 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGORGANIZATIONNAME
|
CSUBCTRG-PURCHASINGDOCUMENTTYPENAME table field -
▼
Description: Field Name: PURCHASINGDOCUMENTTYPENAME Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGDOCUMENTTYPENAME
|
CSUBCTRG-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: BUKRS Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: BUKRS MemoryID: BUK AppClass: FB SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
CSUBCTRG-AUTHORIZATIONGROUP table field - Authorization Group
▼
Description: Authorization Group Field Name: AUTHORIZATIONGROUP Data Element: BRGRU Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: BRGRU MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field AUTHORIZATIONGROUP
|
CSUBCTRG-SUPPLIERACCOUNTGROUP table field - Vendor account group
▼
Description: Vendor account group Field Name: SUPPLIERACCOUNTGROUP Data Element: KTOKK Data Type: CHAR length (Dec): 4(0) Check table: T077K Conversion Routine: Domain Name: KTOKK MemoryID: KGK AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPPLIERACCOUNTGROUP
|