Details |
IDEFECTKEYFIG-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: T000 Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
IDEFECTKEYFIG-DEFECTINTERNALID table field - Internal Defect ID
▼
Description: Internal Defect ID Field Name: DEFECTINTERNALID Data Element: QDEFECTINTERNALID Data Type: CHAR length (Dec): 12(0) Check table: Conversion Routine: Domain Name: QDEFECTINTERNALID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEFECTINTERNALID
|
IDEFECTKEYFIG-INSPECTIONLOT table field - Inspection Lot Number
▼
Description: Inspection Lot Number Field Name: INSPECTIONLOT Data Element: QPLOS Data Type: NUMC length (Dec): 12(0) Check table: Conversion Routine: ALPHA Domain Name: QPLOS MemoryID: QLS AppClass: FBZ SHLP: QALS SHLP Field: PRUEFLOS ConvExit: ALPHA See all SAP tables containing field INSPECTIONLOT
|
IDEFECTKEYFIG-INSPPLANOPERATIONINTERNALID table field - Current Node Number from Order Counter
▼
Description: Current Node Number from Order Counter Field Name: INSPPLANOPERATIONINTERNALID Data Element: QLFNKN Data Type: NUMC length (Dec): 8(0) Check table: Conversion Routine: Domain Name: KNTNR MemoryID: QOPER AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPPLANOPERATIONINTERNALID
|
IDEFECTKEYFIG-INSPECTIONCHARACTERISTIC table field - Inspection Characteristic Number
▼
Description: Inspection Characteristic Number Field Name: INSPECTIONCHARACTERISTIC Data Element: QMERKNRP Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: Domain Name: QMERKNRP MemoryID: QCHAR AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONCHARACTERISTIC
|
IDEFECTKEYFIG-DEFECTCATEGORY table field - Defect Category
▼
Description: Defect Category Field Name: DEFECTCATEGORY Data Element: QDEFCATEGORY Data Type: CHAR length (Dec): 2(0) Check table: TQDEFCAT Conversion Routine: Domain Name: QDEFCATEGORY MemoryID: AppClass: SHLP: QDEFCATEGORY SHLP Field: DEFECTCATEGORY ConvExit: See all SAP tables containing field DEFECTCATEGORY
|
IDEFECTKEYFIG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATE
|
IDEFECTKEYFIG-CREATIONTIME table field - System Time of Creation
▼
Description: System Time of Creation Field Name: CREATIONTIME Data Element: VDM_QERSTEZEIT Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: QZEIT MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONTIME
|
IDEFECTKEYFIG-DEFECTCODE table field - Defect Code
▼
Description: Defect Code Field Name: DEFECTCODE Data Element: VDM_QFECOD Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: QCODE MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEFECTCODE
|
IDEFECTKEYFIG-DEFECTCODEGROUP table field - Defect Code Group
▼
Description: Defect Code Group Field Name: DEFECTCODEGROUP Data Element: VDM_QFEGRP Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QCODEGRP MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEFECTCODEGROUP
|
IDEFECTKEYFIG-WORKCENTERTYPECODE table field - Object types of the CIM resource
▼
Description: Object types of the CIM resource Field Name: WORKCENTERTYPECODE Data Element: CR_OBJTY Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: CR_OBJTY MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKCENTERTYPECODE
|
IDEFECTKEYFIG-MAINWORKCENTERINTERNALID table field - Object ID of the Work Center
▼
Description: Object ID of the Work Center Field Name: MAINWORKCENTERINTERNALID Data Element: LGWID Data Type: NUMC length (Dec): 8(0) Check table: CRID Conversion Routine: Domain Name: CR_OBJID MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAINWORKCENTERINTERNALID
|
IDEFECTKEYFIG-MAINWORKCENTERPLANT table field - Plant for Work Center
▼
Description: Plant for Work Center Field Name: MAINWORKCENTERPLANT Data Element: QARBPWERKS Data Type: CHAR length (Dec): 4(0) Check table: T001W Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAINWORKCENTERPLANT
|
IDEFECTKEYFIG-INSPECTIONSPECIFICATIONTEXT table field - Short Text for Inspection Characteristic
▼
Description: Short Text for Inspection Characteristic Field Name: INSPECTIONSPECIFICATIONTEXT Data Element: VDM_QMKKURZTXT Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: QKURZTEXT MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSPECIFICATIONTEXT
|
IDEFECTKEYFIG-WORKCENTER table field - Work Center
▼
Description: Work Center Field Name: WORKCENTER Data Element: PPH_ARBPL Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: ARBPL MemoryID: AGR AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKCENTER
|
IDEFECTKEYFIG-WORKCENTERTEXT table field - Work Center Text
▼
Description: Work Center Text Field Name: WORKCENTERTEXT Data Element: WORKCENTERTEXT Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: TEXT40 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKCENTERTEXT
|
IDEFECTKEYFIG-INSPECTIONSPECIFICATIONPLANT table field - Plant for Master Inspection Characteristic
▼
Description: Plant for Master Inspection Characteristic Field Name: INSPECTIONSPECIFICATIONPLANT Data Element: VDM_QPMK_WERKS Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: QZAEHLER MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSPECIFICATIONPLANT
|
IDEFECTKEYFIG-INSPECTIONSPECIFICATION table field - Master Inspection Characteristic
▼
Description: Master Inspection Characteristic Field Name: INSPECTIONSPECIFICATION Data Element: QMERKNR Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: ALPHA Domain Name: QMERKNR MemoryID: PMK AppClass: QSS SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field INSPECTIONSPECIFICATION
|
IDEFECTKEYFIG-INSPECTIONSPECIFICATIONVERSION table field - Version Number of Master Inspection Characteristic
▼
Description: Version Number of Master Inspection Characteristic Field Name: INSPECTIONSPECIFICATIONVERSION Data Element: QVERSNRMK Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: ALPHA Domain Name: QVERSNR MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field INSPECTIONSPECIFICATIONVERSION
|
IDEFECTKEYFIG-BILLOFOPERATIONSTYPE table field - Bill of Operations Type
▼
Description: Bill of Operations Type Field Name: BILLOFOPERATIONSTYPE Data Element: VDM_PLNTY Data Type: CHAR length (Dec): 1(0) Check table: TCA01 Conversion Routine: Domain Name: PLNTY MemoryID: PTY AppClass: CP SHLP: H_TCA01 SHLP Field: PLNTY ConvExit: See all SAP tables containing field BILLOFOPERATIONSTYPE
|
IDEFECTKEYFIG-BILLOFOPERATIONSGROUP table field - Bill of Operations Group
▼
Description: Bill of Operations Group Field Name: BILLOFOPERATIONSGROUP Data Element: VDM_PLNNR Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: ALPHA Domain Name: PLNNR MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field BILLOFOPERATIONSGROUP
|
IDEFECTKEYFIG-BOOOPERATIONINTERNALID table field - Number of the Task List Node
▼
Description: Number of the Task List Node Field Name: BOOOPERATIONINTERNALID Data Element: PLNKN Data Type: NUMC length (Dec): 8(0) Check table: Conversion Routine: Domain Name: KNTNR MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field BOOOPERATIONINTERNALID
|
IDEFECTKEYFIG-PLANT table field - Plant
▼
Description: Plant Field Name: PLANT Data Element: WERKS_D Data Type: CHAR length (Dec): 4(0) Check table: T001W Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field PLANT
|
IDEFECTKEYFIG-SUPPLIER table field - Vendor's account number
▼
Description: Vendor's account number Field Name: SUPPLIER Data Element: ELIFN Data Type: CHAR length (Dec): 10(0) Check table: LFA1 Conversion Routine: ALPHA Domain Name: LIFNR MemoryID: LIF AppClass: FB SHLP: KRED_C SHLP Field: LIFNR ConvExit: ALPHA See all SAP tables containing field SUPPLIER
|
IDEFECTKEYFIG-MATERIAL table field - Defective Material
▼
Description: Defective Material Field Name: MATERIAL Data Element: VDM_DEFECTIVE_MATERIAL Data Type: CHAR length (Dec): 40(0) Check table: MARA Conversion Routine: MATN1 Domain Name: MATNR MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: MATN1 See all SAP tables containing field MATERIAL
|
IDEFECTKEYFIG-CUSTOMER table field - Customer (Ship-To Party)
▼
Description: Customer (Ship-To Party) Field Name: CUSTOMER Data Element: VDM_QKUNWE Data Type: CHAR length (Dec): 10(0) Check table: KNA1 Conversion Routine: ALPHA Domain Name: KUNNR MemoryID: AppClass: V SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field CUSTOMER
|
IDEFECTKEYFIG-DEFECTLIFECYCLESTATUS table field - Defect Status
▼
Description: Defect Status Field Name: DEFECTLIFECYCLESTATUS Data Element: QDEFLCYCLESTAT Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: QDEFLCYCLESTAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEFECTLIFECYCLESTATUS
|
IDEFECTKEYFIG-INSPRESULTHISTORYCHARC table field -
▼
Description: Field Name: INSPRESULTHISTORYCHARC Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRESULTHISTORYCHARC
|
IDEFECTKEYFIG-MASTERINSPCHARCSKEY table field -
▼
Description: Field Name: MASTERINSPCHARCSKEY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MASTERINSPCHARCSKEY
|
IDEFECTKEYFIG-NUMBEROFDEFECTS table field - Defects
▼
Description: Defects Field Name: NUMBEROFDEFECTS Data Element: VDM_NUMBEROFDEFECTS Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: VDM_QM_COUNTER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFDEFECTS
|
IDEFECTKEYFIG-NUMBEROFDEFECTSWITHNOTIF table field - No. of Defect Records with Notification
▼
Description: No. of Defect Records with Notification Field Name: NUMBEROFDEFECTSWITHNOTIF Data Element: VDM_DEFECTRECDWTHNOTIFCNT Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: VDM_QM_COUNTER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFDEFECTSWITHNOTIF
|
IDEFECTKEYFIG-NUMBEROFDEFECTSWITHOUTNOTIF table field - No. of Defect Records Without Notification
▼
Description: No. of Defect Records Without Notification Field Name: NUMBEROFDEFECTSWITHOUTNOTIF Data Element: VDM_DEFECTRECDWTHOUTNOTIFCNT Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: VDM_QM_COUNTER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFDEFECTSWITHOUTNOTIF
|
IDEFECTKEYFIG-INSPECTIONLOTORIGIN table field - Inspection Lot Origin
▼
Description: Inspection Lot Origin Field Name: INSPECTIONLOTORIGIN Data Element: VDM_QHERK Data Type: CHAR length (Dec): 2(0) Check table: TQ31 Conversion Routine: Domain Name: QHERK MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONLOTORIGIN
|
IDEFECTKEYFIG-INSPECTIONLOTTYPE table field - Inspection Type
▼
Description: Inspection Type Field Name: INSPECTIONLOTTYPE Data Element: QPART Data Type: CHAR length (Dec): 8(0) Check table: TQ30 Conversion Routine: Domain Name: QPART MemoryID: QLA AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONLOTTYPE
|
IDEFECTKEYFIG-NOTIFICATION table field - Notification Number
▼
Description: Notification Number Field Name: NOTIFICATION Data Element: QMNUM Data Type: CHAR length (Dec): 12(0) Check table: Conversion Routine: ALPHA Domain Name: QMNUM MemoryID: IQM AppClass: INST SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field NOTIFICATION
|
IDEFECTKEYFIG-NOTIFICATIONITEM table field - Item Number in Item Record
▼
Description: Item Number in Item Record Field Name: NOTIFICATIONITEM Data Element: FELFD Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: Domain Name: FELFD MemoryID: AppClass: INST SHLP: SHLP Field: ConvExit: See all SAP tables containing field NOTIFICATIONITEM
|
IDEFECTKEYFIG-MATLQUALITYAUTHORIZATIONGROUP table field - Material Authorization Group for Activities in QM
▼
Description: Material Authorization Group for Activities in QM Field Name: MATLQUALITYAUTHORIZATIONGROUP Data Element: VDM_QMATAUTH Data Type: CHAR length (Dec): 6(0) Check table: TQ01B Conversion Routine: Domain Name: QMATAUTH MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATLQUALITYAUTHORIZATIONGROUP
|
IDEFECTKEYFIG-ISBUSINESSPURPOSECOMPLETED table field - Business Purpose Completed Flag
▼
Description: Business Purpose Completed Flag Field Name: ISBUSINESSPURPOSECOMPLETED Data Element: CVP_XBLCK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CVP_XBLCK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISBUSINESSPURPOSECOMPLETED
|
IDEFECTKEYFIG-MAINWORKCENTER table field - Work Center
▼
Description: Work Center Field Name: MAINWORKCENTER Data Element: PPH_ARBPL Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: ARBPL MemoryID: AGR AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAINWORKCENTER
|