Details |
IEWMWHSETASK-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
IEWMWHSETASK-WAREHOUSE table field - Warehouse Number/Warehouse Complex
▼
Description: Warehouse Number/Warehouse Complex Field Name: WAREHOUSE Data Element: /SCWM/LGNUM Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: /SCWM/LGNUM MemoryID: /SCWM/LGN AppClass: MG SHLP: /SCWM/SH_LGNUM SHLP Field: LGNUM ConvExit: See all SAP tables containing field WAREHOUSE
|
IEWMWHSETASK-WAREHOUSETASK table field - Warehouse Task
▼
Description: Warehouse Task Field Name: WAREHOUSETASK Data Element: /SCWM/TANUM_CONV_ALPHA Data Type: NUMC length (Dec): 12(0) Check table: Conversion Routine: ALPHA Domain Name: /SCWM/TANUM_CONV_ALPHA MemoryID: /SCWM/TAN AppClass: LVS SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field WAREHOUSETASK
|
IEWMWHSETASK-WAREHOUSETASKITEM table field -
▼
Description: Field Name: WAREHOUSETASKITEM Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WAREHOUSETASKITEM
|
IEWMWHSETASK-ISHANDLINGUNITWAREHOUSETASK table field - Handling Unit Warehouse Task
▼
Description: Handling Unit Warehouse Task Field Name: ISHANDLINGUNITWAREHOUSETASK Data Element: /SCWM/FLGHUTO Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISHANDLINGUNITWAREHOUSETASK
|
IEWMWHSETASK-WAREHOUSEPROCESSTYPE table field - Warehouse Process Type
▼
Description: Warehouse Process Type Field Name: WAREHOUSEPROCESSTYPE Data Element: /SCWM/DE_PROCTY Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_PROCTY MemoryID: /SCWM/PRT AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WAREHOUSEPROCESSTYPE
|
IEWMWHSETASK-WAREHOUSEPROCESSCATEGORY table field - Warehouse Process Category
▼
Description: Warehouse Process Category Field Name: WAREHOUSEPROCESSCATEGORY Data Element: /SCWM/LVS_TRART Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: /SCWM/LVS_TRART MemoryID: AppClass: LVS SHLP: SHLP Field: ConvExit: See all SAP tables containing field WAREHOUSEPROCESSCATEGORY
|
IEWMWHSETASK-STORAGEPROCESS table field - Storage Process
▼
Description: Storage Process Field Name: STORAGEPROCESS Data Element: /SCWM/DE_PRCES Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_PRCES MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STORAGEPROCESS
|
IEWMWHSETASK-EXTERNALSTORAGEPROCESSSTEP table field - External Storage Process Step
▼
Description: External Storage Process Step Field Name: EXTERNALSTORAGEPROCESSSTEP Data Element: /SCWM/DE_PROCS Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_PROCS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXTERNALSTORAGEPROCESSSTEP
|
IEWMWHSETASK-WAREHOUSETASKSTATUS table field - Warehouse Task Status
▼
Description: Warehouse Task Status Field Name: WAREHOUSETASKSTATUS Data Element: /SCWM/DE_TOSTAT Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_TOSTAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WAREHOUSETASKSTATUS
|
IEWMWHSETASK-CREATEDBYUSER table field - Created By
▼
Description: Created By Field Name: CREATEDBYUSER Data Element: /SCWM/DE_CREATOR Data Type: CHAR length (Dec): 12(0) Check table: Conversion Routine: Domain Name: UNAME MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATEDBYUSER
|
IEWMWHSETASK-CREATIONDATETIME table field - Creation Time
▼
Description: Creation Time Field Name: CREATIONDATETIME Data Element: /SCWM/DE_CREATED_DT_NOCONV Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: /SCWM/SH_TSTAMP_WHSE SHLP Field: TIMESTAMP ConvExit: See all SAP tables containing field CREATIONDATETIME
|
IEWMWHSETASK-WAREHOUSETASKCODES table field - Calling Application/Special Function for WT Creation/Conf.
▼
Description: Calling Application/Special Function for WT Creation/Conf. Field Name: WAREHOUSETASKCODES Data Element: /SCWM/DE_WTCODE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_WTCODE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WAREHOUSETASKCODES
|
IEWMWHSETASK-EXECUTINGRESOURCE table field - Executing Resource (Means of Transport or User)
▼
Description: Executing Resource (Means of Transport or User) Field Name: EXECUTINGRESOURCE Data Element: /SCWM/DE_PRSRC Data Type: CHAR length (Dec): 18(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_RSRC MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXECUTINGRESOURCE
|
IEWMWHSETASK-WAREHOUSEMOVEMENTSREASON table field - Reason for Movements in the Warehouse
▼
Description: Reason for Movements in the Warehouse Field Name: WAREHOUSEMOVEMENTSREASON Data Element: /SCWM/DE_REASON Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_REASON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WAREHOUSEMOVEMENTSREASON
|
IEWMWHSETASK-PRIORITYCODE table field - Priority
▼
Description: Priority Field Name: PRIORITYCODE Data Element: /SCWM/DE_PRIOR Data Type: INT1 length (Dec): 3(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_PRIOR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRIORITYCODE
|
IEWMWHSETASK-STOCKITEMUUID table field - GUID Stock Item
▼
Description: GUID Stock Item Field Name: STOCKITEMUUID Data Element: /LIME/GUID_STOCK Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STOCKITEMUUID
|
IEWMWHSETASK-CURRENTNUMBEROFKEYTABLE table field - Current Nummer of Key Table
▼
Description: Current Nummer of Key Table Field Name: CURRENTNUMBEROFKEYTABLE Data Element: /LIME/KEY_INDEX Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CURRENTNUMBEROFKEYTABLE
|
IEWMWHSETASK-PRODUCTUUID table field - Product
▼
Description: Product Field Name: PRODUCTUUID Data Element: /SCWM/DE_MATID Data Type: RAW length (Dec): 16(0) Check table: Conversion Routine: MDLPD Domain Name: /SCMB/MDL_MATID_CE MemoryID: AppClass: SHLP: /SCWM/SH_MATNR_COLL SHLP Field: MATID ConvExit: MDLPD See all SAP tables containing field PRODUCTUUID
|
IEWMWHSETASK-PRODUCTNAME table field - Product Number
▼
Description: Product Number Field Name: PRODUCTNAME Data Element: PRODUCTNUMBER Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: MATN1 Domain Name: MATNR MemoryID: MAT AppClass: MG SHLP: S_MAT1 SHLP Field: MATNR ConvExit: MATN1 See all SAP tables containing field PRODUCTNAME
|
IEWMWHSETASK-PRODUCTBATCH table field - Batch
▼
Description: Batch Field Name: PRODUCTBATCH Data Element: /SCWM/DE_BATCHID Data Type: RAW length (Dec): 16(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_BATCHID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTBATCH
|
IEWMWHSETASK-STOCKTYPE table field - Stock Type
▼
Description: Stock Type Field Name: STOCKTYPE Data Element: /LIME/STOCK_CATEGORY Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: /LIME/STOCK_CATEGORY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STOCKTYPE
|
IEWMWHSETASK-STOCKDOCUMENTCATEGORY table field - Type: Sales Order Stock or Project Stock
▼
Description: Type: Sales Order Stock or Project Stock Field Name: STOCKDOCUMENTCATEGORY Data Element: /SCWM/DE_STOCK_DOCCAT Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_STOCK_DOCCAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STOCKDOCUMENTCATEGORY
|
IEWMWHSETASK-STOCKDOCUMENTNUMBER table field - Number of the Sales Order or Project for Special Stock
▼
Description: Number of the Sales Order or Project for Special Stock Field Name: STOCKDOCUMENTNUMBER Data Element: /SCWM/DE_STOCK_DOCNO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STOCKDOCUMENTNUMBER
|
IEWMWHSETASK-STOCKITEMNUMBER table field - Sales Order Item for Sales Order Stock
▼
Description: Sales Order Item for Sales Order Stock Field Name: STOCKITEMNUMBER Data Element: /SCWM/DE_STOCK_ITMNO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STOCKITEMNUMBER
|
IEWMWHSETASK-DOCUMENTCATEGORY table field - Doc. Category for Doc. Reference and Doc.-Related Stock
▼
Description: Doc. Category for Doc. Reference and Doc.-Related Stock Field Name: DOCUMENTCATEGORY Data Element: /SCWM/DE_DOCCAT Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_DOCCAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCUMENTCATEGORY
|
IEWMWHSETASK-STOCKUSAGE table field - Stock Usage
▼
Description: Stock Usage Field Name: STOCKUSAGE Data Element: /LIME/STOCK_USAGE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: /LIME/STOCK_USAGE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STOCKUSAGE
|
IEWMWHSETASK-STOCKOWNER table field - Owner
▼
Description: Owner Field Name: STOCKOWNER Data Element: /SCWM/DE_OWNER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: BPMAP Domain Name: /SCMB/DO_BU_PARTNER MemoryID: AppClass: SHLP: /SCMB/BP SHLP Field: PARTNER ConvExit: BPMAP See all SAP tables containing field STOCKOWNER
|
IEWMWHSETASK-STOCKOWNERPARTNERROLE table field - Partner Role of Owner
▼
Description: Partner Role of Owner Field Name: STOCKOWNERPARTNERROLE Data Element: /LIME/OWNER_ROLE Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: /LIME/PARTNER_ROLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STOCKOWNERPARTNERROLE
|
IEWMWHSETASK-ENTITLEDTODISPOSEPARTY table field - Party Entitled to Dispose
▼
Description: Party Entitled to Dispose Field Name: ENTITLEDTODISPOSEPARTY Data Element: /SCWM/DE_ENTITLED Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: BU_PARTNER MemoryID: /SCWM/ENTITLED AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field ENTITLEDTODISPOSEPARTY
|
IEWMWHSETASK-ENTITLEDTODISPOSEPARTNERROLE table field - Partner Role of Party Entitled to Dispose
▼
Description: Partner Role of Party Entitled to Dispose Field Name: ENTITLEDTODISPOSEPARTNERROLE Data Element: /SCWM/DE_ENTITLED_ROLE Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_PARTNER_ROLE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENTITLEDTODISPOSEPARTNERROLE
|
IEWMWHSETASK-COUNTERFORSTOCKSEPARATION table field - Counter for Stock Separation
▼
Description: Counter for Stock Separation Field Name: COUNTERFORSTOCKSEPARATION Data Element: /SCWM/DE_STOCK_CNT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COUNTERFORSTOCKSEPARATION
|
IEWMWHSETASK-BATCH table field - Batch
▼
Description: Batch Field Name: BATCH Data Element: /SCWM/DE_CHARG Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_CHARG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BATCH
|
IEWMWHSETASK-BASEUNIT table field - Base Unit of Measure
▼
Description: Base Unit of Measure Field Name: BASEUNIT Data Element: /SCWM/DE_BASE_UOM Data Type: UNIT length (Dec): 3(0) Check table: Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field BASEUNIT
|
IEWMWHSETASK-ALTERNATIVEUNIT table field - Alternative Unit of Measure for Stockkeeping Unit
▼
Description: Alternative Unit of Measure for Stockkeeping Unit Field Name: ALTERNATIVEUNIT Data Element: /SCWM/DE_AUNIT Data Type: UNIT length (Dec): 3(0) Check table: Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field ALTERNATIVEUNIT
|
IEWMWHSETASK-TARGETQUANTITYINBASEUNIT table field - Target Quantity in Base Unit of Measure
▼
Description: Target Quantity in Base Unit of Measure Field Name: TARGETQUANTITYINBASEUNIT Data Element: /SCWM/LTAP_VSOLM Data Type: QUAN length (Dec): 31(14) Check table: Conversion Routine: Domain Name: /SCWM/DO_QUANTITY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TARGETQUANTITYINBASEUNIT
|
IEWMWHSETASK-TARGETQUANTITYINALTVUNIT table field - Target Quantity in Alternative Unit of Measure
▼
Description: Target Quantity in Alternative Unit of Measure Field Name: TARGETQUANTITYINALTVUNIT Data Element: /SCWM/LTAP_VSOLA Data Type: QUAN length (Dec): 31(14) Check table: Conversion Routine: Domain Name: /SCWM/DO_QUANTITY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TARGETQUANTITYINALTVUNIT
|
IEWMWHSETASK-WHSETASKRETENTIONQUANTITY table field - Retention Quantity
▼
Description: Retention Quantity Field Name: WHSETASKRETENTIONQUANTITY Data Element: /SCWM/DE_KQUAN Data Type: QUAN length (Dec): 31(14) Check table: Conversion Routine: Domain Name: /SCWM/DO_QUANTITY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHSETASKRETENTIONQUANTITY
|
IEWMWHSETASK-HANDLINGUNITTYPE table field - Handling Unit Type
▼
Description: Handling Unit Type Field Name: HANDLINGUNITTYPE Data Element: /SCWM/DE_HUTYP Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_HUTYP MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field HANDLINGUNITTYPE
|
IEWMWHSETASK-NETWEIGHT table field - Loading or Net Weight
▼
Description: Loading or Net Weight Field Name: NETWEIGHT Data Element: /SCWM/DE_NWEIGHT Data Type: QUAN length (Dec): 15(3) Check table: Conversion Routine: Domain Name: /SCWM/DO_CAP15 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field NETWEIGHT
|
IEWMWHSETASK-WHSETASKNETWEIGHTUNITOFMEASURE table field - Weight Unit
▼
Description: Weight Unit Field Name: WHSETASKNETWEIGHTUNITOFMEASURE Data Element: /SCWM/DE_WGT_UOM Data Type: UNIT length (Dec): 3(0) Check table: Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field WHSETASKNETWEIGHTUNITOFMEASURE
|
IEWMWHSETASK-WHSETASKNETVOLUME table field - Loading or Net Volume
▼
Description: Loading or Net Volume Field Name: WHSETASKNETVOLUME Data Element: /SCWM/DE_NVOLUME Data Type: QUAN length (Dec): 15(3) Check table: Conversion Routine: Domain Name: /SCWM/DO_CAP15 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHSETASKNETVOLUME
|
IEWMWHSETASK-WHSETASKNETVOLUMEUNITOFMEASURE table field - Volume Unit
▼
Description: Volume Unit Field Name: WHSETASKNETVOLUMEUNITOFMEASURE Data Element: /SCWM/DE_VOL_UOM Data Type: UNIT length (Dec): 3(0) Check table: Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field WHSETASKNETVOLUMEUNITOFMEASURE
|
IEWMWHSETASK-WHSETASKCAPACITYCONSUMPTION table field - Capacity Consumption
▼
Description: Capacity Consumption Field Name: WHSETASKCAPACITYCONSUMPTION Data Element: /SCWM/DE_CAPAUSE Data Type: DEC length (Dec): 15(3) Check table: Conversion Routine: Domain Name: /SCWM/DO_DEC15 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHSETASKCAPACITYCONSUMPTION
|
IEWMWHSETASK-PUTAWAYPHYSINVENTORYISPLANNED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: PUTAWAYPHYSINVENTORYISPLANNED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PUTAWAYPHYSINVENTORYISPLANNED
|
IEWMWHSETASK-WHSETASKLOWSTOCKCHECKISPLANNED table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: WHSETASKLOWSTOCKCHECKISPLANNED Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHSETASKLOWSTOCKCHECKISPLANNED
|
IEWMWHSETASK-SHELFLIFEEXPIRATIONDATE table field - Shelf Life Expiration Date
▼
Description: Shelf Life Expiration Date Field Name: SHELFLIFEEXPIRATIONDATE Data Element: /SCWM/SLED Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field SHELFLIFEEXPIRATIONDATE
|
IEWMWHSETASK-WHSETASKGOODSRECEIPTDATETIME table field - Date and Time of Goods Receipt
▼
Description: Date and Time of Goods Receipt Field Name: WHSETASKGOODSRECEIPTDATETIME Data Element: /SCWM/LVS_WDATU_NOCONV Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: /SCWM/SH_TSTAMP_WHSE SHLP Field: TIMESTAMP ConvExit: See all SAP tables containing field WHSETASKGOODSRECEIPTDATETIME
|
IEWMWHSETASK-COUNTRYOFORIGIN table field - Country/Region of Origin
▼
Description: Country/Region of Origin Field Name: COUNTRYOFORIGIN Data Element: /SCWM/DE_COO Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: LAND1 MemoryID: AppClass: SAP SHLP: /SCWM/SH_COO SHLP Field: LAND1 ConvExit: See all SAP tables containing field COUNTRYOFORIGIN
|
IEWMWHSETASK-HAZARDOUSSUBSTANCEINDICATOR table field - Hazardous Substance
▼
Description: Hazardous Substance Field Name: HAZARDOUSSUBSTANCEINDICATOR Data Element: /SCWM/DE_HAZMAT_TO Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field HAZARDOUSSUBSTANCEINDICATOR
|
IEWMWHSETASK-WHSETASKQUALITYINSPECTIONTYPE table field - Inspection ID Type
▼
Description: Inspection ID Type Field Name: WHSETASKQUALITYINSPECTIONTYPE Data Element: /SCWM/DE_INSPIDTYP Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_INSPIDTYP MemoryID: AppClass: SHLP: /SCWM/SH_QINSPIDTYPE SHLP Field: INSPTYPE ConvExit: See all SAP tables containing field WHSETASKQUALITYINSPECTIONTYPE
|
IEWMWHSETASK-QUALITYINSPECTIONDOCUUID table field - Identification of a Quality Object
▼
Description: Identification of a Quality Object Field Name: QUALITYINSPECTIONDOCUUID Data Element: /SCWM/DE_INSPID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field QUALITYINSPECTIONDOCUUID
|
IEWMWHSETASK-STOCKIDENTIFICATIONOFWHSETASK table field - Stock Identification of Warehouse Task
▼
Description: Stock Identification of Warehouse Task Field Name: STOCKIDENTIFICATIONOFWHSETASK Data Element: /SCWM/DE_IDPLATE_WT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STOCKIDENTIFICATIONOFWHSETASK
|
IEWMWHSETASK-CONSOLIDATIONGROUP table field - Consolidation Group
▼
Description: Consolidation Group Field Name: CONSOLIDATIONGROUP Data Element: /SCWM/DE_DSTGRP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONSOLIDATIONGROUP
|
IEWMWHSETASK-SOURCESTORAGETYPE table field - Source Storage Type
▼
Description: Source Storage Type Field Name: SOURCESTORAGETYPE Data Element: /SCWM/LTAP_VLTYP Data Type: CHAR length (Dec): 4(0) Check table: /SCWM/T301 Conversion Routine: Domain Name: /SCWM/LGTYP MemoryID: AppClass: LVS SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOURCESTORAGETYPE
|
IEWMWHSETASK-SOURCESTORAGESECTION table field - Source Storage Section
▼
Description: Source Storage Section Field Name: SOURCESTORAGESECTION Data Element: /SCWM/LTAP_VLBER Data Type: CHAR length (Dec): 4(0) Check table: /SCWM/T302 Conversion Routine: Domain Name: /SCWM/LGBER MemoryID: AppClass: LVS SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOURCESTORAGESECTION
|
IEWMWHSETASK-SOURCESTORAGEBIN table field - Source Storage Bin
▼
Description: Source Storage Bin Field Name: SOURCESTORAGEBIN Data Element: /SCWM/LTAP_VLPLA Data Type: CHAR length (Dec): 18(0) Check table: /SCWM/LAGP Conversion Routine: Domain Name: /SCWM/LGPLA MemoryID: AppClass: LVS SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOURCESTORAGEBIN
|
IEWMWHSETASK-SOURCEHNDLGUNITLOGICALPOSITION table field - Source Logical Position of Handling Unit in Storage Bin
▼
Description: Source Logical Position of Handling Unit in Storage Bin Field Name: SOURCEHNDLGUNITLOGICALPOSITION Data Element: /SCWM/DE_SOURCE_LOGPOS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOURCEHNDLGUNITLOGICALPOSITION
|
IEWMWHSETASK-SOURCERESOURCE table field - Source Resource (Means of Transport or User)
▼
Description: Source Resource (Means of Transport or User) Field Name: SOURCERESOURCE Data Element: /SCWM/DE_SRSRC Data Type: CHAR length (Dec): 18(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_RSRC MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOURCERESOURCE
|
IEWMWHSETASK-SOURCETRANSPORTATIONUNIT table field - Source Transportation Unit (Internal)
▼
Description: Source Transportation Unit (Internal) Field Name: SOURCETRANSPORTATIONUNIT Data Element: /SCWM/DE_STU_NUM Data Type: CHAR length (Dec): 18(0) Check table: Conversion Routine: ALPHA Domain Name: /SCWM/DO_TU_NUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field SOURCETRANSPORTATIONUNIT
|
IEWMWHSETASK-SOURCELOCATIONTYPE table field - Location Type
▼
Description: Location Type Field Name: SOURCELOCATIONTYPE Data Element: /SCWM/DE_LOC_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_LOC_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOURCELOCATIONTYPE
|
IEWMWHSETASK-SOURCEHANDLINGUNITUUID table field - Unique Internal Identification of a Handling Unit
▼
Description: Unique Internal Identification of a Handling Unit Field Name: SOURCEHANDLINGUNITUUID Data Element: /SCWM/GUID_HU Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOURCEHANDLINGUNITUUID
|
IEWMWHSETASK-SOURCEHANDLINGUNIT table field - Source Handling Unit
▼
Description: Source Handling Unit Field Name: SOURCEHANDLINGUNIT Data Element: /SCWM/LTAP_VLENR Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: HUID Domain Name: /SCWM/DO_HUIDENT MemoryID: LEN AppClass: SHLP: SHLP Field: ConvExit: HUID See all SAP tables containing field SOURCEHANDLINGUNIT
|
IEWMWHSETASK-DESTINATIONSTORAGETYPE table field - Destination Storage Type
▼
Description: Destination Storage Type Field Name: DESTINATIONSTORAGETYPE Data Element: /SCWM/LTAP_NLTYP Data Type: CHAR length (Dec): 4(0) Check table: /SCWM/T301 Conversion Routine: Domain Name: /SCWM/LGTYP MemoryID: AppClass: LVS SHLP: SHLP Field: ConvExit: See all SAP tables containing field DESTINATIONSTORAGETYPE
|
IEWMWHSETASK-DESTINATIONSTORAGESECTION table field - Destination Storage Section
▼
Description: Destination Storage Section Field Name: DESTINATIONSTORAGESECTION Data Element: /SCWM/LTAP_NLBER Data Type: CHAR length (Dec): 4(0) Check table: /SCWM/T302 Conversion Routine: Domain Name: /SCWM/LGBER MemoryID: AppClass: LVS SHLP: SHLP Field: ConvExit: See all SAP tables containing field DESTINATIONSTORAGESECTION
|
IEWMWHSETASK-DESTINATIONSTORAGEBIN table field - Destination Storage Bin
▼
Description: Destination Storage Bin Field Name: DESTINATIONSTORAGEBIN Data Element: /SCWM/LTAP_NLPLA Data Type: CHAR length (Dec): 18(0) Check table: /SCWM/LAGP Conversion Routine: Domain Name: /SCWM/LGPLA MemoryID: AppClass: LVS SHLP: SHLP Field: ConvExit: See all SAP tables containing field DESTINATIONSTORAGEBIN
|
IEWMWHSETASK-DESTHNDLGUNITLOGICALPOSITION table field - Destination Logical Position of Handling Unit in Storage Bin
▼
Description: Destination Logical Position of Handling Unit in Storage Bin Field Name: DESTHNDLGUNITLOGICALPOSITION Data Element: /SCWM/DE_DEST_LOGPOS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DESTHNDLGUNITLOGICALPOSITION
|
IEWMWHSETASK-DESTINATIONRESOURCE table field - Destination Resource (Means of Transport or User)
▼
Description: Destination Resource (Means of Transport or User) Field Name: DESTINATIONRESOURCE Data Element: /SCWM/DE_DRSRC Data Type: CHAR length (Dec): 18(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_RSRC MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DESTINATIONRESOURCE
|
IEWMWHSETASK-DESTINATIONTRANSPORTATIONUNIT table field - Destination Transportation Unit (Internal)
▼
Description: Destination Transportation Unit (Internal) Field Name: DESTINATIONTRANSPORTATIONUNIT Data Element: /SCWM/DE_DTU_NUM Data Type: CHAR length (Dec): 18(0) Check table: Conversion Routine: ALPHA Domain Name: /SCWM/DO_TU_NUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field DESTINATIONTRANSPORTATIONUNIT
|
IEWMWHSETASK-DESTINATIONLOCATIONTYPE table field - Location Type
▼
Description: Location Type Field Name: DESTINATIONLOCATIONTYPE Data Element: /SCWM/DE_LOC_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_LOC_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DESTINATIONLOCATIONTYPE
|
IEWMWHSETASK-DESTINATIONHANDLINGUNITUUID table field - Unique Internal Identification of a Handling Unit
▼
Description: Unique Internal Identification of a Handling Unit Field Name: DESTINATIONHANDLINGUNITUUID Data Element: /SCWM/GUID_HU Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DESTINATIONHANDLINGUNITUUID
|
IEWMWHSETASK-DESTINATIONHANDLINGUNIT table field - Destination Handling Unit
▼
Description: Destination Handling Unit Field Name: DESTINATIONHANDLINGUNIT Data Element: /SCWM/LTAP_NLENR Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: HUID Domain Name: /SCWM/DO_HUIDENT MemoryID: LEN AppClass: SHLP: SHLP Field: ConvExit: HUID See all SAP tables containing field DESTINATIONHANDLINGUNIT
|
IEWMWHSETASK-WHSETASKDESTSTORAGEBINDTMNDBY table field - Destination Storage Bin Determined By
▼
Description: Destination Storage Bin Determined By Field Name: WHSETASKDESTSTORAGEBINDTMNDBY Data Element: /SCWM/DE_DESTD Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_DESTD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHSETASKDESTSTORAGEBINDTMNDBY
|
IEWMWHSETASK-WRHSTASKSUBSYSTEMTRANSMN table field - Indicator: Pass on Warehouse Task to Subsystem
▼
Description: Indicator: Pass on Warehouse Task to Subsystem Field Name: WRHSTASKSUBSYSTEMTRANSMN Data Element: /SCWM/LTAP_KZSUB Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: /SCWM/LTAP_KZSUB MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WRHSTASKSUBSYSTEMTRANSMN
|
IEWMWHSETASK-WHSETASKPLANNEDPROCESSINGTIME table field - Planned Proc. Time in Warehouse Task
▼
Description: Planned Proc. Time in Warehouse Task Field Name: WHSETASKPLANNEDPROCESSINGTIME Data Element: /SCWM/LTAP_SOLPO Data Type: QUAN length (Dec): 13(3) Check table: Conversion Routine: Domain Name: PW_QUAN13 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHSETASKPLANNEDPROCESSINGTIME
|
IEWMWHSETASK-WHSETASKPROCGTIMEDETNTIMEUNIT table field - Time Unit
▼
Description: Time Unit Field Name: WHSETASKPROCGTIMEDETNTIMEUNIT Data Element: /SCWM/LVS_ZEIEI Data Type: UNIT length (Dec): 3(0) Check table: Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field WHSETASKPROCGTIMEDETNTIMEUNIT
|
IEWMWHSETASK-WHSETASKREFTOVALUEADDEDSERVICE table field - WT with Reference to a VAS
▼
Description: WT with Reference to a VAS Field Name: WHSETASKREFTOVALUEADDEDSERVICE Data Element: /SCWM/DE_VASTO Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_VASTO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHSETASKREFTOVALUEADDEDSERVICE
|
IEWMWHSETASK-BATCHCHANGEISNOTALLOWED table field - Changing the Batch is not Allowed
▼
Description: Changing the Batch is not Allowed Field Name: BATCHCHANGEISNOTALLOWED Data Element: /SCWM/DE_BATCH_NOCHG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field BATCHCHANGEISNOTALLOWED
|
IEWMWHSETASK-REFERENCEDOCUMENTCATEGORY table field - Doc. Category for Doc. Reference and Doc.-Related Stock
▼
Description: Doc. Category for Doc. Reference and Doc.-Related Stock Field Name: REFERENCEDOCUMENTCATEGORY Data Element: /SCWM/DE_DOCCAT Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_DOCCAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REFERENCEDOCUMENTCATEGORY
|
IEWMWHSETASK-REFERENCEDOCUMENTUUID table field - Doc. Identification for Document-Related Stocks
▼
Description: Doc. Identification for Document-Related Stocks Field Name: REFERENCEDOCUMENTUUID Data Element: /SCWM/DE_DOCID Data Type: RAW length (Dec): 16(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_DOCID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REFERENCEDOCUMENTUUID
|
IEWMWHSETASK-REFERENCEDOCUMENTITEMUUID table field - Document Item for Document-Related Stocks
▼
Description: Document Item for Document-Related Stocks Field Name: REFERENCEDOCUMENTITEMUUID Data Element: /SCWM/DE_ITMID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REFERENCEDOCUMENTITEMUUID
|
IEWMWHSETASK-WAVE table field - Numeric Character Field, Length 10
▼
Description: Numeric Character Field, Length 10 Field Name: WAVE Data Element: NUMC10 Data Type: NUMC length (Dec): 10(0) Check table: Conversion Routine: Domain Name: NUMC10 MemoryID: AppClass: FBZ SHLP: SHLP Field: ConvExit: See all SAP tables containing field WAVE
|
IEWMWHSETASK-WAVEITEM table field - numc06
▼
Description: numc06 Field Name: WAVEITEM Data Element: NUMC06 Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: NUMC06 MemoryID: AppClass: FBZ SHLP: SHLP Field: ConvExit: See all SAP tables containing field WAVEITEM
|
IEWMWHSETASK-WHSETASKTWOSTEPPICKINGTYPE table field - Warehouse Task Type Within Two-Step Picking
▼
Description: Warehouse Task Type Within Two-Step Picking Field Name: WHSETASKTWOSTEPPICKINGTYPE Data Element: /SCWM/DE_L2SKA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_L2SKA MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHSETASKTWOSTEPPICKINGTYPE
|
IEWMWHSETASK-WHSETASKTWOSTEPPICKINGRLVNCE table field - Relevance for Two-Step Picking
▼
Description: Relevance for Two-Step Picking Field Name: WHSETASKTWOSTEPPICKINGRLVNCE Data Element: /SCWM/DE_L2SKR Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_L2SKR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHSETASKTWOSTEPPICKINGRLVNCE
|
IEWMWHSETASK-DOCUMENTRELTDSTOCKDOCCAT table field - Doc. Category for Doc. Reference and Doc.-Related Stock
▼
Description: Doc. Category for Doc. Reference and Doc.-Related Stock Field Name: DOCUMENTRELTDSTOCKDOCCAT Data Element: /SCWM/DE_DOCCAT Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_DOCCAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCUMENTRELTDSTOCKDOCCAT
|
IEWMWHSETASK-DOCUMENTRELTDSTOCKDOCUUID table field - Doc. Identification for Document-Related Stocks
▼
Description: Doc. Identification for Document-Related Stocks Field Name: DOCUMENTRELTDSTOCKDOCUUID Data Element: /SCWM/DE_DOCID Data Type: RAW length (Dec): 16(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_DOCID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCUMENTRELTDSTOCKDOCUUID
|
IEWMWHSETASK-DOCUMENTRELTDSTOCKDOCITEMUUID table field - Document Item for Document-Related Stocks
▼
Description: Document Item for Document-Related Stocks Field Name: DOCUMENTRELTDSTOCKDOCITEMUUID Data Element: /SCWM/DE_ITMID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCUMENTRELTDSTOCKDOCITEMUUID
|
IEWMWHSETASK-STOCKIDENTIFICATIONNUMBER table field - Identification Number of Stock
▼
Description: Identification Number of Stock Field Name: STOCKIDENTIFICATIONNUMBER Data Element: /SCWM/DE_IDPLATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STOCKIDENTIFICATIONNUMBER
|
IEWMWHSETASK-KITITEMISCREATEDAUTOMATICALLY table field - Create Kit Item in HU Automatically During Picking
▼
Description: Create Kit Item in HU Automatically During Picking Field Name: KITITEMISCREATEDAUTOMATICALLY Data Element: /SCWM/DE_KIT_CREA Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field KITITEMISCREATEDAUTOMATICALLY
|
IEWMWHSETASK-WAREHOUSETASKUUID table field - Unique Internal Identification of a Warehouse Task
▼
Description: Unique Internal Identification of a Warehouse Task Field Name: WAREHOUSETASKUUID Data Element: /SCWM/DE_GUID_TO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WAREHOUSETASKUUID
|
IEWMWHSETASK-ISDOCUMENTARYBATCH table field - Truth Value: True/False
▼
Description: Truth Value: True/False Field Name: ISDOCUMENTARYBATCH Data Element: ABAP_BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: ABAP_BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISDOCUMENTARYBATCH
|
IEWMWHSETASK-CONVEYORTECHNIQUESEGMENT table field - Conveyor Technique Segment
▼
Description: Conveyor Technique Segment Field Name: CONVEYORTECHNIQUESEGMENT Data Element: /SCWM/DE_MFSCS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_MFSCS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONVEYORTECHNIQUESEGMENT
|
IEWMWHSETASK-PRODUCTIONSUPPLYAREA table field - Production Supply Area
▼
Description: Production Supply Area Field Name: PRODUCTIONSUPPLYAREA Data Element: /SCWM/DE_PSA Data Type: CHAR length (Dec): 15(0) Check table: Conversion Routine: ALPHA Domain Name: /SCWM/DO_PSA MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field PRODUCTIONSUPPLYAREA
|
IEWMWHSETASK-PRODUCTIONORDER table field - Manufacturing Order
▼
Description: Manufacturing Order Field Name: PRODUCTIONORDER Data Element: /SCWM/DE_PROD_ORDER Data Type: CHAR length (Dec): 12(0) Check table: Conversion Routine: ALPHA Domain Name: AUFNR MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field PRODUCTIONORDER
|
IEWMWHSETASK-WHSETASKCRTNWHSETMZNDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: WHSETASKCRTNWHSETMZNDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHSETASKCRTNWHSETMZNDATETIME
|
IEWMWHSETASK-WHSETASKCHGWHSETMZNDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: WHSETASKCHGWHSETMZNDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHSETASKCHGWHSETMZNDATETIME
|
IEWMWHSETASK-WHSETASKCONFWHSETMZNDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: WHSETASKCONFWHSETMZNDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHSETASKCONFWHSETMZNDATETIME
|
IEWMWHSETASK-WHSETSKPLNDCLSGWHSETMZNDTETME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: WHSETSKPLNDCLSGWHSETMZNDTETME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHSETSKPLNDCLSGWHSETMZNDTETME
|
IEWMWHSETASK-KANBAN table field - Unique Kanban ID
▼
Description: Unique Kanban ID Field Name: KANBAN Data Element: /SCMB/DM_KANBAN_ID Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: KNBCV Domain Name: /SCMB/DM_KANBAN_ID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: KNBCV See all SAP tables containing field KANBAN
|
IEWMWHSETASK-STOCKKEEPINGALTERNATIVEUOM table field - Alternative Unit of Measure for Stockkeeping Unit
▼
Description: Alternative Unit of Measure for Stockkeeping Unit Field Name: STOCKKEEPINGALTERNATIVEUOM Data Element: /SCWM/DE_AUNIT Data Type: UNIT length (Dec): 3(0) Check table: Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field STOCKKEEPINGALTERNATIVEUOM
|
IEWMWHSETASK-ACTIVITYAREA table field - Activity Area
▼
Description: Activity Area Field Name: ACTIVITYAREA Data Element: /SCWM/DE_AAREA Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_AAREA MemoryID: AppClass: SHLP: /SCWM/SH_AAREA SHLP Field: AAREA ConvExit: See all SAP tables containing field ACTIVITYAREA
|
IEWMWHSETASK-QUEUE table field - Queue
▼
Description: Queue Field Name: QUEUE Data Element: /SCWM/DE_QUEUE Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_QUEUE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field QUEUE
|
IEWMWHSETASK-WAREHOUSEORDER table field - Warehouse Order Number
▼
Description: Warehouse Order Number Field Name: WAREHOUSEORDER Data Element: /SCWM/DE_WHO_CONV_ALPHA Data Type: NUMC length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: /SCWM/DO_WHO_CONV_ALPHA MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field WAREHOUSEORDER
|
IEWMWHSETASK-LOGICALRECORDPROGRAMNAME table field - Table Log Record: Program Name
▼
Description: Table Log Record: Program Name Field Name: LOGICALRECORDPROGRAMNAME Data Element: /SCWM/TABLE_LOG_REPID Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: PROGRAMM MemoryID: AppClass: SAB4 SHLP: SHLP Field: ConvExit: See all SAP tables containing field LOGICALRECORDPROGRAMNAME
|
IEWMWHSETASK-LOGICALRECORDTRANSACTIONCODE table field - Table Log Record: Transaction Code
▼
Description: Table Log Record: Transaction Code Field Name: LOGICALRECORDTRANSACTIONCODE Data Element: /SCWM/TABLE_LOG_TCODE Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: TCODE MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field LOGICALRECORDTRANSACTIONCODE
|
IEWMWHSETASK-EWMDUMMYFUNCFORSTRUCTUREEXTN table field - Dummy function in length 1
▼
Description: Dummy function in length 1 Field Name: EWMDUMMYFUNCFORSTRUCTUREEXTN Data Element: DUMMY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: DUMMY MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field EWMDUMMYFUNCFORSTRUCTUREEXTN
|
IEWMWHSETASK-CERTIFICATETEXT table field - Certificate Number
▼
Description: Certificate Number Field Name: CERTIFICATETEXT Data Element: /SCWM/LVS_ZEUGN Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: /SCWM/LVS_ZEUGN MemoryID: AppClass: LVS SHLP: SHLP Field: ConvExit: See all SAP tables containing field CERTIFICATETEXT
|
IEWMWHSETASK-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: LASTCHANGEDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDATETIME
|
IEWMWHSETASK-WAREHOUSEACTIVITYTYPE table field - Activity
▼
Description: Activity Field Name: WAREHOUSEACTIVITYTYPE Data Element: /SCWM/DE_ACTTY Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: /SCWM/DO_ACTTY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WAREHOUSEACTIVITYTYPE
|
IEWMWHSETASK-WHSETASKPLANNEDCLOSINGDATETIME table field - Planned Closing Date/Time
▼
Description: Planned Closing Date/Time Field Name: WHSETASKPLANNEDCLOSINGDATETIME Data Element: /SCWM/DE_TOCOMPL_DT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHSETASKPLANNEDCLOSINGDATETIME
|
IEWMWHSETASK-CONFIRMEDBYUSER table field -
▼
Description: Field Name: CONFIRMEDBYUSER Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONFIRMEDBYUSER
|
IEWMWHSETASK-CONFIRMATIONUTCDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CONFIRMATIONUTCDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONFIRMATIONUTCDATETIME
|
IEWMWHSETASK-PROCESSOR table field -
▼
Description: Field Name: PROCESSOR Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PROCESSOR
|
IEWMWHSETASK-WAREHOUSETASKEXCEPTIONCODE table field -
▼
Description: Field Name: WAREHOUSETASKEXCEPTIONCODE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WAREHOUSETASKEXCEPTIONCODE
|
IEWMWHSETASK-BUSINESSCONTEXT table field -
▼
Description: Field Name: BUSINESSCONTEXT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUSINESSCONTEXT
|
IEWMWHSETASK-BUSINESSCONTEXTEXECUTIONSTEP table field -
▼
Description: Field Name: BUSINESSCONTEXTEXECUTIONSTEP Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUSINESSCONTEXTEXECUTIONSTEP
|
IEWMWHSETASK-EXECUTINGRESOURCEGROUP table field -
▼
Description: Field Name: EXECUTINGRESOURCEGROUP Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXECUTINGRESOURCEGROUP
|
IEWMWHSETASK-EXECUTINGRESOURCETYPE table field -
▼
Description: Field Name: EXECUTINGRESOURCETYPE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXECUTINGRESOURCETYPE
|
IEWMWHSETASK-ACTUALQUANTITYINBASEUNIT table field -
▼
Description: Field Name: ACTUALQUANTITYINBASEUNIT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTUALQUANTITYINBASEUNIT
|
IEWMWHSETASK-ACTUALQUANTITYINALTVUNIT table field -
▼
Description: Field Name: ACTUALQUANTITYINALTVUNIT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTUALQUANTITYINALTVUNIT
|
IEWMWHSETASK-DIFFERENCEQUANTITYINALTVUNIT table field -
▼
Description: Field Name: DIFFERENCEQUANTITYINALTVUNIT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DIFFERENCEQUANTITYINALTVUNIT
|
IEWMWHSETASK-DIFFERENCEQUANTITYINBASEUNIT table field -
▼
Description: Field Name: DIFFERENCEQUANTITYINBASEUNIT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DIFFERENCEQUANTITYINBASEUNIT
|