Details |
IINSPOPCHVRS-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
IINSPOPCHVRS-INSPECTIONPLANGROUP table field - Key for Task List Group
▼
Description: Key for Task List Group Field Name: INSPECTIONPLANGROUP Data Element: PLNNR Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: ALPHA Domain Name: PLNNR MemoryID: PLN AppClass: CP SHLP: PLKS SHLP Field: PLNNR ConvExit: ALPHA See all SAP tables containing field INSPECTIONPLANGROUP
|
IINSPOPCHVRS-BOOOPERATIONINTERNALID table field - Number of the Task List Node
▼
Description: Number of the Task List Node Field Name: BOOOPERATIONINTERNALID Data Element: PLNKN Data Type: NUMC length (Dec): 8(0) Check table: Conversion Routine: Domain Name: KNTNR MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field BOOOPERATIONINTERNALID
|
IINSPOPCHVRS-BOOCHARACTERISTIC table field - Inspection Characteristic Number
▼
Description: Inspection Characteristic Number Field Name: BOOCHARACTERISTIC Data Element: QMERKNRP Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: Domain Name: QMERKNRP MemoryID: QCHAR AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field BOOCHARACTERISTIC
|
IINSPOPCHVRS-BOOCHARACTERISTICVERSION table field - Internal counter
▼
Description: Internal counter Field Name: BOOCHARACTERISTICVERSION Data Element: CIM_COUNT Data Type: NUMC length (Dec): 8(0) Check table: Conversion Routine: Domain Name: CIM_COUNT MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field BOOCHARACTERISTICVERSION
|
IINSPOPCHVRS-INSPECTIONPLAN table field - Group Counter
▼
Description: Group Counter Field Name: INSPECTIONPLAN Data Element: PLNAL Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: ALPHA Domain Name: ALTNR MemoryID: PAL AppClass: CS SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field INSPECTIONPLAN
|
IINSPOPCHVRS-BILLOFOPERATIONSTYPE table field - Task List Type
▼
Description: Task List Type Field Name: BILLOFOPERATIONSTYPE Data Element: PLNTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: PLNTY MemoryID: PTY AppClass: CP SHLP: H_TCA01 SHLP Field: PLNTY ConvExit: See all SAP tables containing field BILLOFOPERATIONSTYPE
|
IINSPOPCHVRS-INSPECTIONPLANINTERNALVERSION table field - Internal counter
▼
Description: Internal counter Field Name: INSPECTIONPLANINTERNALVERSION Data Element: CIM_COUNT Data Type: NUMC length (Dec): 8(0) Check table: Conversion Routine: Domain Name: CIM_COUNT MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONPLANINTERNALVERSION
|
IINSPOPCHVRS-BOOOPINTERNALVERSIONCOUNTER table field - Internal counter
▼
Description: Internal counter Field Name: BOOOPINTERNALVERSIONCOUNTER Data Element: CIM_COUNT Data Type: NUMC length (Dec): 8(0) Check table: Conversion Routine: Domain Name: CIM_COUNT MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field BOOOPINTERNALVERSIONCOUNTER
|
IINSPOPCHVRS-VALIDITYSTARTDATE table field - Valid-From Date
▼
Description: Valid-From Date Field Name: VALIDITYSTARTDATE Data Element: DATUV Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field VALIDITYSTARTDATE
|
IINSPOPCHVRS-VALIDITYENDDATE table field - Valid-to date
▼
Description: Valid-to date Field Name: VALIDITYENDDATE Data Element: DATUB Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field VALIDITYENDDATE
|
IINSPOPCHVRS-CHANGENUMBER table field - Change Number
▼
Description: Change Number Field Name: CHANGENUMBER Data Element: AENNR Data Type: CHAR length (Dec): 12(0) Check table: Conversion Routine: ALPHA Domain Name: AENNR MemoryID: AEN AppClass: CS SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field CHANGENUMBER
|
IINSPOPCHVRS-ISDELETED table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISDELETED Data Element: LKENZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISDELETED
|
IINSPOPCHVRS-BOOOPERATIONPRTINTERNALID table field - Assigned Test Equipment
▼
Description: Assigned Test Equipment Field Name: BOOOPERATIONPRTINTERNALID Data Element: QPZLFH Data Type: NUMC length (Dec): 8(0) Check table: Conversion Routine: Domain Name: PZLFH MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field BOOOPERATIONPRTINTERNALID
|
IINSPOPCHVRS-INSPECTIONMETHOD table field - Inspection Method
▼
Description: Inspection Method Field Name: INSPECTIONMETHOD Data Element: QPMETHODE Data Type: CHAR length (Dec): 8(0) Check table: QMTB Conversion Routine: ALPHA Domain Name: QPMETHODE MemoryID: PMT AppClass: QSS SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field INSPECTIONMETHOD
|
IINSPOPCHVRS-INSPECTIONMETHODVERSION table field - Version Number of Inspection Method
▼
Description: Version Number of Inspection Method Field Name: INSPECTIONMETHODVERSION Data Element: QVERSNRPM Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: ALPHA Domain Name: QVERSNR MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field INSPECTIONMETHODVERSION
|
IINSPOPCHVRS-INSPECTIONMETHODPLANT table field - Plant for Inspection Method
▼
Description: Plant for Inspection Method Field Name: INSPECTIONMETHODPLANT Data Element: Q_METH_PLANT Data Type: CHAR length (Dec): 4(0) Check table: T001W Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: H_T001W SHLP Field: WERKS ConvExit: See all SAP tables containing field INSPECTIONMETHODPLANT
|
IINSPOPCHVRS-INSPSPECIMPORTANCECODE table field - Weighting of Characteristic
▼
Description: Weighting of Characteristic Field Name: INSPSPECIMPORTANCECODE Data Element: QMERKGEW Data Type: CHAR length (Dec): 2(0) Check table: TQ17A Conversion Routine: Domain Name: QMERKKLAS MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECIMPORTANCECODE
|
IINSPOPCHVRS-INSPECTORQUALIFICATION table field - Inspector Qualification
▼
Description: Inspector Qualification Field Name: INSPECTORQUALIFICATION Data Element: QPRQUALIF Data Type: CHAR length (Dec): 5(0) Check table: TQ11 Conversion Routine: Domain Name: QPRQUALIF MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTORQUALIFICATION
|
IINSPOPCHVRS-INSPECTIONSPECIFICATION table field - Master Inspection Characteristic
▼
Description: Master Inspection Characteristic Field Name: INSPECTIONSPECIFICATION Data Element: QMERKNR Data Type: CHAR length (Dec): 8(0) Check table: QPMK Conversion Routine: ALPHA Domain Name: QMERKNR MemoryID: PMK AppClass: QSS SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field INSPECTIONSPECIFICATION
|
IINSPOPCHVRS-INSPECTIONSPECIFICATIONVERSION table field - Version Number of Master Inspection Characteristic
▼
Description: Version Number of Master Inspection Characteristic Field Name: INSPECTIONSPECIFICATIONVERSION Data Element: QVERSNRMK Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: ALPHA Domain Name: QVERSNR MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field INSPECTIONSPECIFICATIONVERSION
|
IINSPOPCHVRS-INSPECTIONSPECIFICATIONPLANT table field - Plant for the Master Inspection Characteristic
▼
Description: Plant for the Master Inspection Characteristic Field Name: INSPECTIONSPECIFICATIONPLANT Data Element: QZAEHLER Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: QZAEHLER MemoryID: WRK AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSPECIFICATIONPLANT
|
IINSPOPCHVRS-BOOCHARCHASINSPSPECREFERENCE table field - Reference to Master Insp. Characteristic in Task List
▼
Description: Reference to Master Insp. Characteristic in Task List Field Name: BOOCHARCHASINSPSPECREFERENCE Data Element: QKZ_REF Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field BOOCHARCHASINSPSPECREFERENCE
|
IINSPOPCHVRS-INSPSPECCONTROLINDICATORS table field - Cntrl Indicator String for Insp. Char./Master Insp. Char.
▼
Description: Cntrl Indicator String for Insp. Char./Master Insp. Char. Field Name: INSPSPECCONTROLINDICATORS Data Element: QMKCONTROL Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: QMKCONTROL MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECCONTROLINDICATORS
|
IINSPOPCHVRS-INSPSPECISQUANTITATIVE table field - Is Quantitative Characteristic
▼
Description: Is Quantitative Characteristic Field Name: INSPSPECISQUANTITATIVE Data Element: VDM_QKZQUNMK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: VDM_QKZ_BOOL MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISQUANTITATIVE
|
IINSPOPCHVRS-INSPSPECCHARACTERISTICTYPE table field - Characteristic Type
▼
Description: Characteristic Type Field Name: INSPSPECCHARACTERISTICTYPE Data Element: VDM_QCHAR_TYPE_BASIC Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QCHAR_TYPE_BASIC MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECCHARACTERISTICTYPE
|
IINSPOPCHVRS-INSPSPECISMEASUREDVALUERQD table field - Measured Values Must Be Recorded
▼
Description: Measured Values Must Be Recorded Field Name: INSPSPECISMEASUREDVALUERQD Data Element: QKZQUMK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISMEASUREDVALUERQD
|
IINSPOPCHVRS-INSPSPECISSELECTEDSETREQUIRED table field - Reference to Characteristic Attribute Required
▼
Description: Reference to Characteristic Attribute Required Field Name: INSPSPECISSELECTEDSETREQUIRED Data Element: QKZPKAT Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISSELECTEDSETREQUIRED
|
IINSPOPCHVRS-INSPSPECISUPPERLIMITREQUIRED table field - Upper Specification Limit
▼
Description: Upper Specification Limit Field Name: INSPSPECISUPPERLIMITREQUIRED Data Element: QKZTOLOB Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISUPPERLIMITREQUIRED
|
IINSPOPCHVRS-INSPSPECISLOWERLIMITREQUIRED table field - Lower Specification Limit
▼
Description: Lower Specification Limit Field Name: INSPSPECISLOWERLIMITREQUIRED Data Element: QKZTOLUN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISLOWERLIMITREQUIRED
|
IINSPOPCHVRS-INSPSPECISTARGETVALUEINLIMIT table field - Check Target Value
▼
Description: Check Target Value Field Name: INSPSPECISTARGETVALUEINLIMIT Data Element: QKZSOLLPR Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISTARGETVALUEINLIMIT
|
IINSPOPCHVRS-INSPECTIONSCOPE table field - Inspection Scope
▼
Description: Inspection Scope Field Name: INSPECTIONSCOPE Data Element: QPUMFKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QPUMFKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSCOPE
|
IINSPOPCHVRS-INSPSPECISLONGTERMINSPECTION table field - Long-Term Inspection
▼
Description: Long-Term Inspection Field Name: INSPSPECISLONGTERMINSPECTION Data Element: QLZEITKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISLONGTERMINSPECTION
|
IINSPOPCHVRS-INSPSPECRECORDINGTYPE table field - Recording Type
▼
Description: Recording Type Field Name: INSPSPECRECORDINGTYPE Data Element: QESTUKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QESTUKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECRECORDINGTYPE
|
IINSPOPCHVRS-INSPRESULTISDOCUMENTATIONRQD table field - Documentation Required for Inspection Result
▼
Description: Documentation Required for Inspection Result Field Name: INSPRESULTISDOCUMENTATIONRQD Data Element: VDM_QDOKUKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QDOKUKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRESULTISDOCUMENTATIONRQD
|
IINSPOPCHVRS-INSPSPECCHARCCATEGORY table field - Characteristic Category
▼
Description: Characteristic Category Field Name: INSPSPECCHARCCATEGORY Data Element: VDM_QRZWANG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QRZWANG MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECCHARCCATEGORY
|
IINSPOPCHVRS-INSPSPECISSAMPLEQTYADDITIVE table field - Inspection Sample Quantity Is Added
▼
Description: Inspection Sample Quantity Is Added Field Name: INSPSPECISSAMPLEQTYADDITIVE Data Element: QADDPRO Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISSAMPLEQTYADDITIVE
|
IINSPOPCHVRS-INSPSPECISDESTRUCTIVE table field - Destructive Inspection
▼
Description: Destructive Inspection Field Name: INSPSPECISDESTRUCTIVE Data Element: QKZDESTROY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISDESTRUCTIVE
|
IINSPOPCHVRS-INSPSPECRESULTCALCULATION table field - Characteristic Result Calculation
▼
Description: Characteristic Result Calculation Field Name: INSPSPECRESULTCALCULATION Data Element: VDM_QKZFORMEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZFORMEL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECRESULTCALCULATION
|
IINSPOPCHVRS-INSPSPECISSAMPLINGPROCEDRQD table field - Sampling Procedure Is Required
▼
Description: Sampling Procedure Is Required Field Name: INSPSPECISSAMPLINGPROCEDRQD Data Element: QSTICHPR Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISSAMPLINGPROCEDRQD
|
IINSPOPCHVRS-INSPSPECISSCRAPRELEVANT table field - Characteristic Relevant for Quality Score and Scrap Share
▼
Description: Characteristic Relevant for Quality Score and Scrap Share Field Name: INSPSPECISSCRAPRELEVANT Data Element: QAUSSLOS Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISSCRAPRELEVANT
|
IINSPOPCHVRS-INSPSPECHASFIXEDCTRLINDICATORS table field - Default Control Indicators Cannot Be Changed
▼
Description: Default Control Indicators Cannot Be Changed Field Name: INSPSPECHASFIXEDCTRLINDICATORS Data Element: QNAENDKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECHASFIXEDCTRLINDICATORS
|
IINSPOPCHVRS-INSPSPECISDEFECTRECORDINGRQD table field - Recording the Number of Defects
▼
Description: Recording the Number of Defects Field Name: INSPSPECISDEFECTRECORDINGRQD Data Element: QBFHLZHL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISDEFECTRECORDINGRQD
|
IINSPOPCHVRS-INSPSPECISTESTEQUIPMENTRQD table field - Assignment of Test Equipment Required
▼
Description: Assignment of Test Equipment Required Field Name: INSPSPECISTESTEQUIPMENTRQD Data Element: QPMZWANG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISTESTEQUIPMENTRQD
|
IINSPOPCHVRS-INSPSPECISDEFECTSRECGAUTOMATIC table field - Defects Recording Automatically Called Up
▼
Description: Defects Recording Automatically Called Up Field Name: INSPSPECISDEFECTSRECGAUTOMATIC Data Element: QFEHLREC Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISDEFECTSRECGAUTOMATIC
|
IINSPOPCHVRS-INSPSPECISCHGDOCREQUIRED table field - Create Change Documents During Results Recording
▼
Description: Create Change Documents During Results Recording Field Name: INSPSPECISCHGDOCREQUIRED Data Element: QKZAENBEL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISCHGDOCREQUIRED
|
IINSPOPCHVRS-INSPSPECISCONTROLCHARTUSED table field - SPC Characteristic
▼
Description: SPC Characteristic Field Name: INSPSPECISCONTROLCHARTUSED Data Element: QSPCMK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISCONTROLCHARTUSED
|
IINSPOPCHVRS-INSPSPECPRINTCONTROL table field - Inspection Print Control
▼
Description: Inspection Print Control Field Name: INSPSPECPRINTCONTROL Data Element: VDM_QDRUCK1 Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QDRUCK1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECPRINTCONTROL
|
IINSPOPCHVRS-INSPTOLERANCESPECIFICATION table field - Tolerance Key
▼
Description: Tolerance Key Field Name: INSPTOLERANCESPECIFICATION Data Element: QTOLERANZ Data Type: CHAR length (Dec): 4(0) Check table: TQ29 Conversion Routine: Domain Name: QTOLERANZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPTOLERANCESPECIFICATION
|
IINSPOPCHVRS-INSPSPECDECIMALPLACES table field - Number of Places to the Right of a Decimal Point (Accuracy)
▼
Description: Number of Places to the Right of a Decimal Point (Accuracy) Field Name: INSPSPECDECIMALPLACES Data Element: QSTELLEN Data Type: INT1 length (Dec): 3(0) Check table: Conversion Routine: Domain Name: QSTELLEN MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECDECIMALPLACES
|
IINSPOPCHVRS-INSPECTIONSPECIFICATIONUNIT table field - Unit of Measurement in Which Quantitative Data Is Stored
▼
Description: Unit of Measurement in Which Quantitative Data Is Stored Field Name: INSPECTIONSPECIFICATIONUNIT Data Element: QMASSEH Data Type: UNIT length (Dec): 3(0) Check table: T006 Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field INSPECTIONSPECIFICATIONUNIT
|
IINSPOPCHVRS-INSPSPECTARGETVALUE table field - Target Value for a Quantitative Characteristic
▼
Description: Target Value for a Quantitative Characteristic Field Name: INSPSPECTARGETVALUE Data Element: QSOLLWERTE Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSOLLWERTE MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECTARGETVALUE
|
IINSPOPCHVRS-INSPSPECHASTARGETVALUE table field - Value Not Initial if Set
▼
Description: Value Not Initial if Set Field Name: INSPSPECHASTARGETVALUE Data Element: QNINITIAL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECHASTARGETVALUE
|
IINSPOPCHVRS-INSPSPECUPPERLIMIT table field - Upper Specification Limit
▼
Description: Upper Specification Limit Field Name: INSPSPECUPPERLIMIT Data Element: QTOLOB Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSOLLWERTE MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECUPPERLIMIT
|
IINSPOPCHVRS-INSPSPECLOWERLIMIT table field - Lower Specification Limit
▼
Description: Lower Specification Limit Field Name: INSPSPECLOWERLIMIT Data Element: QTOLUN Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSOLLWERTE MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECLOWERLIMIT
|
IINSPOPCHVRS-INSPSPECHASLOWERLIMIT table field - Value Not Initial if Set
▼
Description: Value Not Initial if Set Field Name: INSPSPECHASLOWERLIMIT Data Element: QNINITIAL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECHASLOWERLIMIT
|
IINSPOPCHVRS-INSPSPECHASUPPERLIMIT table field - Value Not Initial if Set
▼
Description: Value Not Initial if Set Field Name: INSPSPECHASUPPERLIMIT Data Element: QNINITIAL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECHASUPPERLIMIT
|
IINSPOPCHVRS-INSPSPECINPUTPROCEDURE table field - Parameters for Input Processing in QM Results Recording
▼
Description: Parameters for Input Processing in QM Results Recording Field Name: INSPSPECINPUTPROCEDURE Data Element: QINPPROC Data Type: CHAR length (Dec): 3(0) Check table: TQ71 Conversion Routine: Domain Name: CHAR3 MemoryID: AppClass: SDIC SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECINPUTPROCEDURE
|
IINSPOPCHVRS-INSPSPECHASFORMULA table field - Check and Calculate Formula in QM
▼
Description: Check and Calculate Formula in QM Field Name: INSPSPECHASFORMULA Data Element: QFORMELSL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QFORMELSL MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECHASFORMULA
|
IINSPOPCHVRS-INSPSPECFORMULA1 table field - Formula Field
▼
Description: Formula Field Field Name: INSPSPECFORMULA1 Data Element: QFORMEL Data Type: CHAR length (Dec): 60(0) Check table: Conversion Routine: Domain Name: QFORMEL MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECFORMULA1
|
IINSPOPCHVRS-INSPSPECFORMULA2 table field - Formula Field
▼
Description: Formula Field Field Name: INSPSPECFORMULA2 Data Element: QFORMEL Data Type: CHAR length (Dec): 60(0) Check table: Conversion Routine: Domain Name: QFORMEL MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECFORMULA2
|
IINSPOPCHVRS-INSPSPECNUMBEROFCLASSES table field - Number of Value Classes for Inspection Results
▼
Description: Number of Value Classes for Inspection Results Field Name: INSPSPECNUMBEROFCLASSES Data Element: QKLASSZAHL Data Type: INT1 length (Dec): 3(0) Check table: Conversion Routine: Domain Name: QKLASSZAHL MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECNUMBEROFCLASSES
|
IINSPOPCHVRS-INSPSPECCLASSWIDTHQTY table field - Class Width
▼
Description: Class Width Field Name: INSPSPECCLASSWIDTHQTY Data Element: QKLASSBR Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSOLLWERTE MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECCLASSWIDTHQTY
|
IINSPOPCHVRS-INSPSPECHASCLASSWIDTH table field - Value Not Initial if Set
▼
Description: Value Not Initial if Set Field Name: INSPSPECHASCLASSWIDTH Data Element: QNINITIAL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECHASCLASSWIDTH
|
IINSPOPCHVRS-INSPSPECCLASSMIDPOINTQTY table field - Class Midpoint
▼
Description: Class Midpoint Field Name: INSPSPECCLASSMIDPOINTQTY Data Element: QKLASSMIT Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSOLLWERTE MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECCLASSMIDPOINTQTY
|
IINSPOPCHVRS-INSPSPECHASCLASSMIDPOINT table field - Value Not Initial if Set
▼
Description: Value Not Initial if Set Field Name: INSPSPECHASCLASSMIDPOINT Data Element: QNINITIAL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECHASCLASSMIDPOINT
|
IINSPOPCHVRS-INSPSPECFIRSTUPPERSPECLIMIT table field - First Upper Specification Limit
▼
Description: First Upper Specification Limit Field Name: INSPSPECFIRSTUPPERSPECLIMIT Data Element: QGRENZOB1 Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSOLLWERTE MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECFIRSTUPPERSPECLIMIT
|
IINSPOPCHVRS-INSPSPECHASFIRSTUPPERSPECLIMIT table field - Value Not Initial if Set
▼
Description: Value Not Initial if Set Field Name: INSPSPECHASFIRSTUPPERSPECLIMIT Data Element: QNINITIAL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECHASFIRSTUPPERSPECLIMIT
|
IINSPOPCHVRS-INSPSPECFIRSTLOWERSPECLIMIT table field - First Lower Specification Limit
▼
Description: First Lower Specification Limit Field Name: INSPSPECFIRSTLOWERSPECLIMIT Data Element: QGRENZUN1 Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSOLLWERTE MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECFIRSTLOWERSPECLIMIT
|
IINSPOPCHVRS-INSPSPECHASFIRSTLOWERSPECLIMIT table field - Value Not Initial if Set
▼
Description: Value Not Initial if Set Field Name: INSPSPECHASFIRSTLOWERSPECLIMIT Data Element: QNINITIAL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECHASFIRSTLOWERSPECLIMIT
|
IINSPOPCHVRS-INSPSPECSECONDUPPERSPECLIMIT table field - Second Upper Specification Limit
▼
Description: Second Upper Specification Limit Field Name: INSPSPECSECONDUPPERSPECLIMIT Data Element: QGRENZOB2 Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSOLLWERTE MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECSECONDUPPERSPECLIMIT
|
IINSPOPCHVRS-INSPSPECHASSECONDUPRSPECLIMIT table field - Value Not Initial if Set
▼
Description: Value Not Initial if Set Field Name: INSPSPECHASSECONDUPRSPECLIMIT Data Element: QNINITIAL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECHASSECONDUPRSPECLIMIT
|
IINSPOPCHVRS-INSPSPECSECONDLOWERSPECLIMIT table field - Second Lower Specification Limit
▼
Description: Second Lower Specification Limit Field Name: INSPSPECSECONDLOWERSPECLIMIT Data Element: QGRENZUN2 Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSOLLWERTE MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECSECONDLOWERSPECLIMIT
|
IINSPOPCHVRS-INSPSPECHASSECONDLOWRSPECLIMIT table field - Value Not Initial if Set
▼
Description: Value Not Initial if Set Field Name: INSPSPECHASSECONDLOWRSPECLIMIT Data Element: QNINITIAL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECHASSECONDLOWRSPECLIMIT
|
IINSPOPCHVRS-INSPSPECDEFECTCODEGRPREJECTION table field - Defect Code Group for General Rejection
▼
Description: Defect Code Group for General Rejection Field Name: INSPSPECDEFECTCODEGRPREJECTION Data Element: QCODEGRPQL Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QCODEGRP MemoryID: CGP AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECDEFECTCODEGRPREJECTION
|
IINSPOPCHVRS-INSPSPECDEFECTCODEREJECTION table field - Defect Code for Rejection: General
▼
Description: Defect Code for Rejection: General Field Name: INSPSPECDEFECTCODEREJECTION Data Element: QCODEQL Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: QCODE MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECDEFECTCODEREJECTION
|
IINSPOPCHVRS-INSPSPECDEFECTCODEGRPRJCNUPPER table field - Defect Code Group for Rejection at Upper Tolerance
▼
Description: Defect Code Group for Rejection at Upper Tolerance Field Name: INSPSPECDEFECTCODEGRPRJCNUPPER Data Element: QCODEGRPO Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QCODEGRP MemoryID: CGP AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECDEFECTCODEGRPRJCNUPPER
|
IINSPOPCHVRS-INSPSPECDEFECTCODERJCNUPPER table field - Defect Code for Rejection at Upper Specification Limit
▼
Description: Defect Code for Rejection at Upper Specification Limit Field Name: INSPSPECDEFECTCODERJCNUPPER Data Element: QCODEO Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: QCODE MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECDEFECTCODERJCNUPPER
|
IINSPOPCHVRS-INSPSPECDEFECTCODEGRPRJCNLOWER table field - Defect Code Group for Rejection at Lower Tolerance
▼
Description: Defect Code Group for Rejection at Lower Tolerance Field Name: INSPSPECDEFECTCODEGRPRJCNLOWER Data Element: QCODEGRPU Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QCODEGRP MemoryID: CGP AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECDEFECTCODEGRPRJCNLOWER
|
IINSPOPCHVRS-INSPSPECDEFECTCODERJCNLOWER table field - Defect Code for Rejection at Lower Specification Limit
▼
Description: Defect Code for Rejection at Lower Specification Limit Field Name: INSPSPECDEFECTCODERJCNLOWER Data Element: QCODEU Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: QCODE MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECDEFECTCODERJCNLOWER
|
IINSPOPCHVRS-SELECTEDCODESET table field - Assigned Code Group or Selected Set
▼
Description: Assigned Code Group or Selected Set Field Name: SELECTEDCODESET Data Element: QCGRAUSW Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QCGRAUSW MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field SELECTEDCODESET
|
IINSPOPCHVRS-SELECTEDCODESETPLANT table field - Plant of the Assigned Selected Set
▼
Description: Plant of the Assigned Selected Set Field Name: SELECTEDCODESETPLANT Data Element: QWERKAUSW Data Type: CHAR length (Dec): 4(0) Check table: T001W Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field SELECTEDCODESETPLANT
|
IINSPOPCHVRS-INSPSPECADDITIONALCATALOG2 table field - Catalog Type of Assigned Code Group or Selected Set
▼
Description: Catalog Type of Assigned Code Group or Selected Set Field Name: INSPSPECADDITIONALCATALOG2 Data Element: QKATAUSW Data Type: CHAR length (Dec): 1(0) Check table: TQ15 Conversion Routine: Domain Name: QKATART MemoryID: QKT AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDITIONALCATALOG2
|
IINSPOPCHVRS-INSPSPECADDITIONALSELECTEDSET2 table field - Assigned Code Group or Selected Set
▼
Description: Assigned Code Group or Selected Set Field Name: INSPSPECADDITIONALSELECTEDSET2 Data Element: QCGRAUSW Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QCGRAUSW MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDITIONALSELECTEDSET2
|
IINSPOPCHVRS-INSPSPECADDITIONALCODEGROUP2 table field - Assigned Code Group or Selected Set
▼
Description: Assigned Code Group or Selected Set Field Name: INSPSPECADDITIONALCODEGROUP2 Data Element: QCGRAUSW Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QCGRAUSW MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDITIONALCODEGROUP2
|
IINSPOPCHVRS-INSPSPECADDLSELDCODESETPLANT2 table field - Plant of the Assigned Selected Set
▼
Description: Plant of the Assigned Selected Set Field Name: INSPSPECADDLSELDCODESETPLANT2 Data Element: QWERKAUSW Data Type: CHAR length (Dec): 4(0) Check table: T001W Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDLSELDCODESETPLANT2
|
IINSPOPCHVRS-INSPSPECADDITIONALCATALOG3 table field - Catalog Type of Assigned Code Group or Selected Set
▼
Description: Catalog Type of Assigned Code Group or Selected Set Field Name: INSPSPECADDITIONALCATALOG3 Data Element: QKATAUSW Data Type: CHAR length (Dec): 1(0) Check table: TQ15 Conversion Routine: Domain Name: QKATART MemoryID: QKT AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDITIONALCATALOG3
|
IINSPOPCHVRS-INSPSPECADDITIONALSELECTEDSET3 table field - Assigned Code Group or Selected Set
▼
Description: Assigned Code Group or Selected Set Field Name: INSPSPECADDITIONALSELECTEDSET3 Data Element: QCGRAUSW Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QCGRAUSW MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDITIONALSELECTEDSET3
|
IINSPOPCHVRS-INSPSPECADDITIONALCODEGROUP3 table field - Assigned Code Group or Selected Set
▼
Description: Assigned Code Group or Selected Set Field Name: INSPSPECADDITIONALCODEGROUP3 Data Element: QCGRAUSW Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QCGRAUSW MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDITIONALCODEGROUP3
|
IINSPOPCHVRS-INSPSPECADDLSELDCODESETPLANT3 table field - Plant of the Assigned Selected Set
▼
Description: Plant of the Assigned Selected Set Field Name: INSPSPECADDLSELDCODESETPLANT3 Data Element: QWERKAUSW Data Type: CHAR length (Dec): 4(0) Check table: T001W Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDLSELDCODESETPLANT3
|
IINSPOPCHVRS-INSPSPECADDITIONALCATALOG4 table field - Catalog Type of Assigned Code Group or Selected Set
▼
Description: Catalog Type of Assigned Code Group or Selected Set Field Name: INSPSPECADDITIONALCATALOG4 Data Element: QKATAUSW Data Type: CHAR length (Dec): 1(0) Check table: TQ15 Conversion Routine: Domain Name: QKATART MemoryID: QKT AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDITIONALCATALOG4
|
IINSPOPCHVRS-INSPSPECADDITIONALSELECTEDSET4 table field - Assigned Code Group or Selected Set
▼
Description: Assigned Code Group or Selected Set Field Name: INSPSPECADDITIONALSELECTEDSET4 Data Element: QCGRAUSW Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QCGRAUSW MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDITIONALSELECTEDSET4
|
IINSPOPCHVRS-INSPSPECADDITIONALCODEGROUP4 table field - Assigned Code Group or Selected Set
▼
Description: Assigned Code Group or Selected Set Field Name: INSPSPECADDITIONALCODEGROUP4 Data Element: QCGRAUSW Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QCGRAUSW MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDITIONALCODEGROUP4
|
IINSPOPCHVRS-INSPSPECADDLSELDCODESETPLANT4 table field - Plant of the Assigned Selected Set
▼
Description: Plant of the Assigned Selected Set Field Name: INSPSPECADDLSELDCODESETPLANT4 Data Element: QWERKAUSW Data Type: CHAR length (Dec): 4(0) Check table: T001W Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDLSELDCODESETPLANT4
|
IINSPOPCHVRS-INSPSPECADDITIONALCATALOG5 table field - Catalog Type of Assigned Code Group or Selected Set
▼
Description: Catalog Type of Assigned Code Group or Selected Set Field Name: INSPSPECADDITIONALCATALOG5 Data Element: QKATAUSW Data Type: CHAR length (Dec): 1(0) Check table: TQ15 Conversion Routine: Domain Name: QKATART MemoryID: QKT AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDITIONALCATALOG5
|
IINSPOPCHVRS-INSPSPECADDITIONALSELECTEDSET5 table field - Assigned Code Group or Selected Set
▼
Description: Assigned Code Group or Selected Set Field Name: INSPSPECADDITIONALSELECTEDSET5 Data Element: QCGRAUSW Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QCGRAUSW MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDITIONALSELECTEDSET5
|
IINSPOPCHVRS-INSPSPECADDITIONALCODEGROUP5 table field - Assigned Code Group or Selected Set
▼
Description: Assigned Code Group or Selected Set Field Name: INSPSPECADDITIONALCODEGROUP5 Data Element: QCGRAUSW Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QCGRAUSW MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDITIONALCODEGROUP5
|
IINSPOPCHVRS-INSPSPECADDLSELDCODESETPLANT5 table field - Plant of the Assigned Selected Set
▼
Description: Plant of the Assigned Selected Set Field Name: INSPSPECADDLSELDCODESETPLANT5 Data Element: QWERKAUSW Data Type: CHAR length (Dec): 4(0) Check table: T001W Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDLSELDCODESETPLANT5
|
IINSPOPCHVRS-SAMPLINGPROCEDURE table field - Sampling Procedure in Inspection Characteristic
▼
Description: Sampling Procedure in Inspection Characteristic Field Name: SAMPLINGPROCEDURE Data Element: QSTICHVERF Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QSTPRVER MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field SAMPLINGPROCEDURE
|
IINSPOPCHVRS-INSPCHARACTERISTICSAMPLEUNIT table field - Sample Unit of Measure
▼
Description: Sample Unit of Measure Field Name: INSPCHARACTERISTICSAMPLEUNIT Data Element: QPROBME Data Type: UNIT length (Dec): 3(0) Check table: T006 Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field INSPCHARACTERISTICSAMPLEUNIT
|
IINSPOPCHVRS-BOOCHARCSAMPLEQUANTITY table field - Sample Quantity Factor for Sample(Mult. Sample Unit of Msr.)
▼
Description: Sample Quantity Factor for Sample(Mult. Sample Unit of Msr.) Field Name: BOOCHARCSAMPLEQUANTITY Data Element: QPROBEFAK Data Type: DEC length (Dec): 5(2) Check table: Conversion Routine: Domain Name: QPROBEFAK MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field BOOCHARCSAMPLEQUANTITY
|
IINSPOPCHVRS-QLTYCTRLCHARTAGGRGNCRITERION table field - SPC Criterion
▼
Description: SPC Criterion Field Name: QLTYCTRLCHARTAGGRGNCRITERION Data Element: QSPCKRIT Data Type: CHAR length (Dec): 3(0) Check table: QPSP Conversion Routine: Domain Name: QSPCKRIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field QLTYCTRLCHARTAGGRGNCRITERION
|
IINSPOPCHVRS-INSPSPECINFORMATIONFIELD1 table field - Text Line for Additional Information
▼
Description: Text Line for Additional Information Field Name: INSPSPECINFORMATIONFIELD1 Data Element: QTXT10 Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: QTXT10 MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECINFORMATIONFIELD1
|
IINSPOPCHVRS-INSPSPECINFORMATIONFIELD2 table field - Text Line for Additional Information
▼
Description: Text Line for Additional Information Field Name: INSPSPECINFORMATIONFIELD2 Data Element: QTXT20 Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: QTXT20 MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECINFORMATIONFIELD2
|
IINSPOPCHVRS-INSPSPECINFORMATIONFIELD3 table field - Text Line for Additional Information
▼
Description: Text Line for Additional Information Field Name: INSPSPECINFORMATIONFIELD3 Data Element: QTXT40 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: QTXT40 MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECINFORMATIONFIELD3
|
IINSPOPCHVRS-INSPECTIONSPECIFICATIONTEXT table field - Short Text for Inspection Characteristic
▼
Description: Short Text for Inspection Characteristic Field Name: INSPECTIONSPECIFICATIONTEXT Data Element: QTXT_CHA Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: QKURZTEXT MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSPECIFICATIONTEXT
|
IINSPOPCHVRS-INSPLOTDYNAMICRULE table field - Dynamic Modification Rule
▼
Description: Dynamic Modification Rule Field Name: INSPLOTDYNAMICRULE Data Element: QDYNREGEL Data Type: CHAR length (Dec): 3(0) Check table: QDDR Conversion Routine: Domain Name: QDYNREGEL MemoryID: QDR AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPLOTDYNAMICRULE
|
IINSPOPCHVRS-INSPCHARCDYNMODIFREF table field - Characteristic (in Plan) whose Q-Level Will Be Copied
▼
Description: Characteristic (in Plan) whose Q-Level Will Be Copied Field Name: INSPCHARCDYNMODIFREF Data Element: QMERKDYN Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: Domain Name: QMERKNRP MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPCHARCDYNMODIFREF
|
IINSPOPCHVRS-MATLISCONSIDEREDFORDYNMODIF table field - Material Considered for Dynamic Modification
▼
Description: Material Considered for Dynamic Modification Field Name: MATLISCONSIDEREDFORDYNMODIF Data Element: QMATKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATLISCONSIDEREDFORDYNMODIF
|
IINSPOPCHVRS-SUPLRISCONSIDEREDFORDYNMODIF table field - Supplier Considered for Dynamic Modification
▼
Description: Supplier Considered for Dynamic Modification Field Name: SUPLRISCONSIDEREDFORDYNMODIF Data Element: QLIFKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPLRISCONSIDEREDFORDYNMODIF
|
IINSPOPCHVRS-MFRISCONSIDEREDFORDYNMODIF table field - Manufacturer Considered for Dynamic Modification
▼
Description: Manufacturer Considered for Dynamic Modification Field Name: MFRISCONSIDEREDFORDYNMODIF Data Element: QHERSTKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field MFRISCONSIDEREDFORDYNMODIF
|
IINSPOPCHVRS-CUSTISCONSIDEREDFORDYNMODIF table field - Customer Considered for Dynamic Modification
▼
Description: Customer Considered for Dynamic Modification Field Name: CUSTISCONSIDEREDFORDYNMODIF Data Element: QKUNDKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field CUSTISCONSIDEREDFORDYNMODIF
|
IINSPOPCHVRS-CREATEDBYUSER table field - User who created record
▼
Description: User who created record Field Name: CREATEDBYUSER Data Element: ANNAM Data Type: CHAR length (Dec): 12(0) Check table: Conversion Routine: Domain Name: USNAM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATEDBYUSER
|
IINSPOPCHVRS-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATE
|
IINSPOPCHVRS-LASTCHANGEDBYUSER table field - Name of User Who Last Changed Data Record
▼
Description: Name of User Who Last Changed Data Record Field Name: LASTCHANGEDBYUSER Data Element: QAENDERER Data Type: CHAR length (Dec): 12(0) Check table: Conversion Routine: Domain Name: QAENDERER MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDBYUSER
|
IINSPOPCHVRS-LASTCHANGEDATE table field - System Date on Which Data Record Was Changed
▼
Description: System Date on Which Data Record Was Changed Field Name: LASTCHANGEDATE Data Element: QDATUMAEND Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDATE
|
IINSPOPCHVRS-BILLOFOPERATIONSVERSION table field - Routing Version
▼
Description: Routing Version Field Name: BILLOFOPERATIONSVERSION Data Element: PLNVERSN Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: ALPHA Domain Name: PLNVERSN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field BILLOFOPERATIONSVERSION
|