SAP IPVCONTRACTVH table - Generated Table for View details in SAP
SAP IPVCONTRACTVH table summary
Warning: Undefined array key "id" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 101Object Name: IPVCONTRACTVH
Dictionary Type: Table view
Description: Generated Table for View
Field list for IPVCONTRACTVH table on an S/4 SAP system
Details |
IPVCONTRACTVH-MANDT table field - Client ▼Description: Client |
IPVCONTRACTVH-PRACONTRACT table field - Contract Number ▼Description: Contract Number |
IPVCONTRACTVH-PRACONTRACTDESC table field - Contract Description ▼Description: Contract Description |
IPVCONTRACTVH-PRACONTRACTDATE table field - Document Date (Date Received/Sent) ▼Description: Document Date (Date Received/Sent) |
IPVCONTRACTVH-SOLDTOPARTY table field - Sold-to Party ▼Description: Sold-to Party |
IPVCONTRACTVH-COMPANYCODE table field - Company Code ▼Description: Company Code |
IPVCONTRACTVH-PRACONTRACTTYPE table field - Contract Type ▼Description: Contract Type |
IPVCONTRACTVH-ISAPPROVED table field - Approval indicator ▼Description: Approval indicator |
IPVCONTRACTVH-PREVIOUSPRACONTRACT table field - Old / Previous Contract Number ▼Description: Old / Previous Contract Number |
IPVCONTRACTVH-CUSTOMERORSUPPLIERTYPE table field - Customer/Vendor Indicator ▼Description: Customer/Vendor Indicator |
IPVCONTRACTVH-MARKETINGREP table field - Marketing Representative No ▼Description: Marketing Representative No |
IPVCONTRACTVH-MARKETINGREPINTRSTSEQUNMBR table field - Marketing Representative Interest Sequence No ▼Description: Marketing Representative Interest Sequence No |
IPVCONTRACTVH-MARKETINGREPNAME table field - Marketing Representative Name ▼Description: Marketing Representative Name |
IPVCONTRACTVH-MARKETINGREPCUSTOMER table field - Marketing Representative Customer ▼Description: Marketing Representative Customer |
IPVCONTRACTVH-MARKETINGREPSUPPLIER table field - Marketing Representative Supplier ▼Description: Marketing Representative Supplier |
IPVCONTRACTVH-CREATEDBYUSER table field - Name of Person Responsible for Creating the Object ▼Description: Name of Person Responsible for Creating the Object |
IPVCONTRACTVH-CREATIONDATE table field - Date on which the record was created ▼Description: Date on which the record was created |
IPVCONTRACTVH-CREATIONTIME table field - Creation Time ▼Description: Creation Time |
Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 234 Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 278 Warning: Undefined variable $obj1 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj2 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj3 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj4 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj5 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj6 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj7 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj8 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj9 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj10 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj11 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
View list of all SAP tables(S4H/ECC)
Select data from SAP table