IWCCAPOVWTP-LASTCHANGEDATETIME table field - Packed field ▼
Description: Packed field Field Name: LASTCHANGEDATETIME Data Element: DEC15 Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: DEC15 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit:
IWCCAPOVWTP-CAPACITYACTIVEVERSION table field - Active Version of Available Capacity ▼
Description: Active Version of Available Capacity Field Name: CAPACITYACTIVEVERSION Data Element: KAPVERSAKT Data Type: NUMC length (Dec): 2(0) Check table: TC36 Conversion Routine: Domain Name: KAPVERSION MemoryID: AppClass: SHLP: SHLP Field: ConvExit:
IWCCAPOVWTP-WORKCENTERRESPONSIBLE table field - Person Responsible for the Work Center ▼
Description: Person Responsible for the Work Center Field Name: WORKCENTERRESPONSIBLE Data Element: AP_VERAN Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: AP_VERAN MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit:
IWCCAPOVWTP-CAPACITYLASTCHANGEDATETIME table field - Capacity Last Change Date Time ▼
Description: Capacity Last Change Date Time Field Name: CAPACITYLASTCHANGEDATETIME Data Element: KAP_LASTCHANGE_DATETIME Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit:
Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 234
Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 278
Warning: Undefined variable $obj1 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj2 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj3 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj4 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj5 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj6 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj7 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj8 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj9 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj10 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
Warning: Undefined variable $obj11 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279