Details |
P_MCONSSFDWGR-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: T000 Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
P_MCONSSFDWGR-RLDNR table field - Ledger
▼
Description: Ledger Field Name: RLDNR Data Element: RLDNR Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: ALPHA Domain Name: RLDNR MemoryID: GLN AppClass: FG SHLP: H_T881 SHLP Field: RLDNR ConvExit: ALPHA See all SAP tables containing field RLDNR
|
P_MCONSSFDWGR-RDIMEN table field - Dimension
▼
Description: Dimension Field Name: RDIMEN Data Element: FC_DIMEN Data Type: CHAR length (Dec): 2(0) Check table: TF150 Conversion Routine: Domain Name: FC_DIMEN MemoryID: DIN AppClass: SHLP: FC_DIMEN SHLP Field: DIMEN ConvExit: See all SAP tables containing field RDIMEN
|
P_MCONSSFDWGR-RYEAR table field - Fiscal Year
▼
Description: Fiscal Year Field Name: RYEAR Data Element: FIS_GJAHR Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: GJAHR Domain Name: GJAHR MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: GJAHR See all SAP tables containing field RYEAR
|
P_MCONSSFDWGR-DOCNR table field - Accounting Document Number
▼
Description: Accounting Document Number Field Name: DOCNR Data Element: BELNR_D Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: BELNR MemoryID: BLN AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field DOCNR
|
P_MCONSSFDWGR-DOCLN table field - Six-Character Posting Item for Ledger
▼
Description: Six-Character Posting Item for Ledger Field Name: DOCLN Data Element: DOCLN6 Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: DOCLN6 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCLN
|
P_MCONSSFDWGR-RRCTY table field - Record Type
▼
Description: Record Type Field Name: RRCTY Data Element: RRCTY Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: RRCTY MemoryID: AppClass: FG SHLP: SHLP Field: ConvExit: See all SAP tables containing field RRCTY
|
P_MCONSSFDWGR-RVERS table field - Version
▼
Description: Version Field Name: RVERS Data Element: RVERS Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: ALPHA Domain Name: RVERS MemoryID: GVS AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field RVERS
|
P_MCONSSFDWGR-RTCUR table field - Currency Key
▼
Description: Currency Key Field Name: RTCUR Data Element: RTCUR Data Type: CUKY length (Dec): 5(0) Check table: Conversion Routine: Domain Name: WAERS MemoryID: FWS AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field RTCUR
|
P_MCONSSFDWGR-RHCUR table field - Currency key of the local currency
▼
Description: Currency key of the local currency Field Name: RHCUR Data Element: LCURR Data Type: CUKY length (Dec): 5(0) Check table: TCURC Conversion Routine: Domain Name: WAERS MemoryID: GLC AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field RHCUR
|
P_MCONSSFDWGR-RKCUR table field - Currency key of the ledger currency
▼
Description: Currency key of the ledger currency Field Name: RKCUR Data Element: GCURR Data Type: CUKY length (Dec): 5(0) Check table: Conversion Routine: Domain Name: WAERS MemoryID: FWS AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field RKCUR
|
P_MCONSSFDWGR-RUNIT table field - Base Unit of Measure
▼
Description: Base Unit of Measure Field Name: RUNIT Data Element: MEINS Data Type: UNIT length (Dec): 3(0) Check table: Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field RUNIT
|
P_MCONSSFDWGR-DRCRK table field - Debit/Credit Indicator
▼
Description: Debit/Credit Indicator Field Name: DRCRK Data Element: SHKZG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SHKZG MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field DRCRK
|
P_MCONSSFDWGR-POPER table field - Posting period
▼
Description: Posting period Field Name: POPER Data Element: POPER Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: POPER MemoryID: POPR AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field POPER
|
P_MCONSSFDWGR-FISCYEARPER table field - Fiscal Year + Fiscal Period
▼
Description: Fiscal Year + Fiscal Period Field Name: FISCYEARPER Data Element: FINS_FYEARPERIOD Data Type: NUMC length (Dec): 7(0) Check table: Conversion Routine: Domain Name: FINS_FYEARPERIOD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FISCYEARPER
|
P_MCONSSFDWGR-PERIOD_MODE table field - Period Mode
▼
Description: Period Mode Field Name: PERIOD_MODE Data Element: FINCS_PERIOD_MODE Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: FINCS_PERIOD_MODE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PERIOD_MODE
|
P_MCONSSFDWGR-POPER_POSTING table field - Posting period
▼
Description: Posting period Field Name: POPER_POSTING Data Element: POPER Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: POPER MemoryID: POPR AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field POPER_POSTING
|
P_MCONSSFDWGR-DOCCT table field - Document Category
▼
Description: Document Category Field Name: DOCCT Data Element: DOCCT Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: DOCCT MemoryID: GCT AppClass: FGI SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCCT
|
P_MCONSSFDWGR-RCOMP table field - Company
▼
Description: Company Field Name: RCOMP Data Element: RCOMP_D Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: ALPHA Domain Name: RCOMP MemoryID: GCC AppClass: FGI SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field RCOMP
|
P_MCONSSFDWGR-RBUNIT table field - Consolidation Unit
▼
Description: Consolidation Unit Field Name: RBUNIT Data Element: FC_BUNIT Data Type: CHAR length (Dec): 18(0) Check table: TF160 Conversion Routine: AFIMC Domain Name: FC_BUNIT MemoryID: BUN AppClass: SHLP: SHLP Field: ConvExit: AFIMC See all SAP tables containing field RBUNIT
|
P_MCONSSFDWGR-RITCLG table field - Consolidation Chart of Accounts
▼
Description: Consolidation Chart of Accounts Field Name: RITCLG Data Element: FC_ITCLG Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: FC_ITCLG MemoryID: ITC AppClass: SHLP: FC_ITCLG SHLP Field: ITCLG ConvExit: See all SAP tables containing field RITCLG
|
P_MCONSSFDWGR-RITEM table field - Financial Statement Item
▼
Description: Financial Statement Item Field Name: RITEM Data Element: FC_ITEM Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: BFIMC Domain Name: FC_ITEM MemoryID: ITM AppClass: SHLP: SHLP Field: ConvExit: BFIMC See all SAP tables containing field RITEM
|
P_MCONSSFDWGR-RBUPTR table field - Partner Unit
▼
Description: Partner Unit Field Name: RBUPTR Data Element: FC_BUPTR Data Type: CHAR length (Dec): 18(0) Check table: Conversion Routine: AFIMC Domain Name: FC_BUNIT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: AFIMC See all SAP tables containing field RBUPTR
|
P_MCONSSFDWGR-RCONGR table field - Consolidation Group
▼
Description: Consolidation Group Field Name: RCONGR Data Element: FC_CONGR Data Type: CHAR length (Dec): 18(0) Check table: TF180 Conversion Routine: AFIMC Domain Name: FC_CONGR MemoryID: CGR AppClass: SHLP: SHLP Field: ConvExit: AFIMC See all SAP tables containing field RCONGR
|
P_MCONSSFDWGR-ROBUKRS table field - Original company code
▼
Description: Original company code Field Name: ROBUKRS Data Element: OBUKR Data Type: CHAR length (Dec): 4(0) Check table: T001 Conversion Routine: Domain Name: BUKRS MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field ROBUKRS
|
P_MCONSSFDWGR-SITYP table field - Subitem Category
▼
Description: Subitem Category Field Name: SITYP Data Element: FC_SITYP Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: FC_SITYP MemoryID: STP AppClass: SHLP: FC_SITYP SHLP Field: SITYP ConvExit: See all SAP tables containing field SITYP
|
P_MCONSSFDWGR-SUBIT table field - Subitem
▼
Description: Subitem Field Name: SUBIT Data Element: FC_SITEM Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: FC_SITEM MemoryID: STM AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUBIT
|
P_MCONSSFDWGR-PLEVL table field - Posting Level
▼
Description: Posting Level Field Name: PLEVL Data Element: FC_PLEVL Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: FC_PLEVL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLEVL
|
P_MCONSSFDWGR-RPFLG table field - Apportionment
▼
Description: Apportionment Field Name: RPFLG Data Element: FC_RPFLG Data Type: NUMC length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FC_RPFLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RPFLG
|
P_MCONSSFDWGR-RTFLG table field - Currency Translation
▼
Description: Currency Translation Field Name: RTFLG Data Element: FC_RTFLG Data Type: NUMC length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FC_RTFLG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RTFLG
|
P_MCONSSFDWGR-DOCTY table field - Document Type
▼
Description: Document Type Field Name: DOCTY Data Element: FC_DOCTY Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: FC_DOCTY MemoryID: BAR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCTY
|
P_MCONSSFDWGR-YRACQ table field - Year of Acquisition
▼
Description: Year of Acquisition Field Name: YRACQ Data Element: FC_RYACQ Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: GJAHR Domain Name: GJAHR MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: GJAHR See all SAP tables containing field YRACQ
|
P_MCONSSFDWGR-PRACQ table field - Period of Acquisition
▼
Description: Period of Acquisition Field Name: PRACQ Data Element: RPACQ Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: NUM03 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRACQ
|
P_MCONSSFDWGR-COICU table field - Investee Unit
▼
Description: Investee Unit Field Name: COICU Data Element: FC_COICU Data Type: CHAR length (Dec): 18(0) Check table: Conversion Routine: AFIMC Domain Name: FC_BUNIT MemoryID: CCU AppClass: SHLP: SHLP Field: ConvExit: AFIMC See all SAP tables containing field COICU
|
P_MCONSSFDWGR-TSL table field - Value in Transaction Currency
▼
Description: Value in Transaction Currency Field Name: TSL Data Element: VTCUR9 Data Type: CURR length (Dec): 23(2) Check table: Conversion Routine: AC172 Domain Name: AFLE17D2O23S_TO_23D2O31S MemoryID: AppClass: SHLP: SHLP Field: ConvExit: AC172 See all SAP tables containing field TSL
|
P_MCONSSFDWGR-HSL table field - Value in Local Currency
▼
Description: Value in Local Currency Field Name: HSL Data Element: VLCUR9 Data Type: CURR length (Dec): 23(2) Check table: Conversion Routine: AC172 Domain Name: AFLE17D2O23S_TO_23D2O31S MemoryID: AppClass: SHLP: SHLP Field: ConvExit: AC172 See all SAP tables containing field HSL
|
P_MCONSSFDWGR-KSL table field - Value in Group Currency
▼
Description: Value in Group Currency Field Name: KSL Data Element: VGCUR9 Data Type: CURR length (Dec): 23(2) Check table: Conversion Routine: AC172 Domain Name: AFLE17D2O23S_TO_23D2O31S MemoryID: AppClass: SHLP: SHLP Field: ConvExit: AC172 See all SAP tables containing field KSL
|
P_MCONSSFDWGR-MSL table field - Quantity
▼
Description: Quantity Field Name: MSL Data Element: FINCS_QUAN Data Type: QUAN length (Dec): 29(8) Check table: Conversion Routine: Domain Name: FINCS_QUAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MSL
|
P_MCONSSFDWGR-SGTXT table field - Item Text
▼
Description: Item Text Field Name: SGTXT Data Element: SGTXT Data Type: CHAR length (Dec): 50(0) Check table: Conversion Routine: Domain Name: TEXT50 MemoryID: AppClass: SLG SHLP: SHLP Field: ConvExit: See all SAP tables containing field SGTXT
|
P_MCONSSFDWGR-AUTOM table field - Indicator: Automatic posting lines
▼
Description: Indicator: Automatic posting lines Field Name: AUTOM Data Element: AUTOM Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: TEXT1 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field AUTOM
|
P_MCONSSFDWGR-ACTIV table field - Business Transaction
▼
Description: Business Transaction Field Name: ACTIV Data Element: GLVOR Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CHAR4 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTIV
|
P_MCONSSFDWGR-BVORG table field - Number of Cross-Company Code Posting Transaction
▼
Description: Number of Cross-Company Code Posting Transaction Field Name: BVORG Data Element: BVORG Data Type: CHAR length (Dec): 16(0) Check table: Conversion Routine: Domain Name: BVORG MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field BVORG
|
P_MCONSSFDWGR-BUDAT table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: BUDAT Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUDAT
|
P_MCONSSFDWGR-WSDAT table field - Value Date for Currency Translation
▼
Description: Value Date for Currency Translation Field Name: WSDAT Data Element: WSDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: WSD AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field WSDAT
|
P_MCONSSFDWGR-REFDOCNR table field - Accounting Document Number
▼
Description: Accounting Document Number Field Name: REFDOCNR Data Element: BELNR_D Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: BELNR MemoryID: BLN AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field REFDOCNR
|
P_MCONSSFDWGR-REFRYEAR table field - Fiscal Year
▼
Description: Fiscal Year Field Name: REFRYEAR Data Element: GJAHR Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: GJAHR Domain Name: GJAHR MemoryID: GJR AppClass: SAP SHLP: SHLP Field: ConvExit: GJAHR See all SAP tables containing field REFRYEAR
|
P_MCONSSFDWGR-REFDOCLN table field - Six-figure number of line item
▼
Description: Six-figure number of line item Field Name: REFDOCLN Data Element: BUZEI6 Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: BUZEI6 MemoryID: BUZ AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REFDOCLN
|
P_MCONSSFDWGR-REFDOCCT table field - Document Category
▼
Description: Document Category Field Name: REFDOCCT Data Element: DOCCT Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: DOCCT MemoryID: GCT AppClass: FGI SHLP: SHLP Field: ConvExit: See all SAP tables containing field REFDOCCT
|
P_MCONSSFDWGR-REFACTIV table field - Business Transaction
▼
Description: Business Transaction Field Name: REFACTIV Data Element: GLVOR Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CHAR4 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field REFACTIV
|
P_MCONSSFDWGR-TIMESTAMP table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: TIMESTAMP Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TIMESTAMP
|
P_MCONSSFDWGR-CPUDT table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CPUDT Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field CPUDT
|
P_MCONSSFDWGR-CPUTM table field - Time of Entry
▼
Description: Time of Entry Field Name: CPUTM Data Element: CPUTM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field CPUTM
|
P_MCONSSFDWGR-USNAM table field - User Name
▼
Description: User Name Field Name: USNAM Data Element: USNAM Data Type: CHAR length (Dec): 12(0) Check table: Conversion Routine: Domain Name: XUBNAME MemoryID: USR AppClass: SUSR SHLP: SHLP Field: ConvExit: See all SAP tables containing field USNAM
|
P_MCONSSFDWGR-RVSDOCNR table field - Reverse Document Number
▼
Description: Reverse Document Number Field Name: RVSDOCNR Data Element: STBLG Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: BELNR MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field RVSDOCNR
|
P_MCONSSFDWGR-ORNDOCNR table field - Number of Reversed Document
▼
Description: Number of Reversed Document Field Name: ORNDOCNR Data Element: STBLN Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: BELNR MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field ORNDOCNR
|
P_MCONSSFDWGR-COIAC table field - Consolidation of Investments Activity
▼
Description: Consolidation of Investments Activity Field Name: COIAC Data Element: FC_COIAC Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: FC_COIAC MemoryID: COA AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COIAC
|
P_MCONSSFDWGR-COINR table field - Consolidation of Investments Activity Number
▼
Description: Consolidation of Investments Activity Number Field Name: COINR Data Element: FC_COINR Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: BELNR MemoryID: CNR AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field COINR
|
P_MCONSSFDWGR-REVYEAR table field - Year of reversal document or reversed document
▼
Description: Year of reversal document or reversed document Field Name: REVYEAR Data Element: FC_REVYEAR Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: GJAHR Domain Name: GJAHR MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: GJAHR See all SAP tables containing field REVYEAR
|
P_MCONSSFDWGR-AWTYP table field - Reference procedure
▼
Description: Reference procedure Field Name: AWTYP Data Element: AWTYP Data Type: CHAR length (Dec): 5(0) Check table: TTYP Conversion Routine: Domain Name: AWTYP MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field AWTYP
|
P_MCONSSFDWGR-AWORG table field - Reference Organizational Units
▼
Description: Reference Organizational Units Field Name: AWORG Data Element: AWORG Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: AWORG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AWORG
|
P_MCONSSFDWGR-LOGSYS table field - Logical system
▼
Description: Logical system Field Name: LOGSYS Data Element: LOGSYS Data Type: CHAR length (Dec): 10(0) Check table: TBDLS Conversion Routine: ALPHA Domain Name: LOGSYS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field LOGSYS
|
P_MCONSSFDWGR-KTOPL table field - Chart of Accounts
▼
Description: Chart of Accounts Field Name: KTOPL Data Element: KTOPL Data Type: CHAR length (Dec): 4(0) Check table: T004 Conversion Routine: Domain Name: KTOPL MemoryID: KPL AppClass: FB SHLP: C_KTOPL SHLP Field: KTOPL ConvExit: See all SAP tables containing field KTOPL
|
P_MCONSSFDWGR-RACCT table field - Account Number
▼
Description: Account Number Field Name: RACCT Data Element: RACCT Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: SAKNR MemoryID: ACC AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field RACCT
|
P_MCONSSFDWGR-XBLNR table field - Reference Document Number
▼
Description: Reference Document Number Field Name: XBLNR Data Element: XBLNR1 Data Type: CHAR length (Dec): 16(0) Check table: Conversion Routine: Domain Name: XBLNR1 MemoryID: AppClass: MB SHLP: SHLP Field: ConvExit: See all SAP tables containing field XBLNR
|
P_MCONSSFDWGR-ZUONR table field - Assignment number
▼
Description: Assignment number Field Name: ZUONR Data Element: DZUONR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ZUONR
|
P_MCONSSFDWGR-RCNTR table field - Cost Center
▼
Description: Cost Center Field Name: RCNTR Data Element: KOSTL Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: KOSTL MemoryID: KOS AppClass: KA SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field RCNTR
|
P_MCONSSFDWGR-PRCTR table field - Profit Center
▼
Description: Profit Center Field Name: PRCTR Data Element: PRCTR Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: PRCTR MemoryID: PRC AppClass: KE SHLP: PRCTR_EMPTY SHLP Field: PRCTR ConvExit: ALPHA See all SAP tables containing field PRCTR
|
P_MCONSSFDWGR-RFAREA table field - Functional Area
▼
Description: Functional Area Field Name: RFAREA Data Element: FKBER Data Type: CHAR length (Dec): 16(0) Check table: Conversion Routine: Domain Name: FKBER MemoryID: FBE AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RFAREA
|
P_MCONSSFDWGR-RBUSA table field - Business Area
▼
Description: Business Area Field Name: RBUSA Data Element: GSBER Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: GSBER MemoryID: GSB AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field RBUSA
|
P_MCONSSFDWGR-KOKRS table field - Controlling Area
▼
Description: Controlling Area Field Name: KOKRS Data Element: KOKRS Data Type: CHAR length (Dec): 4(0) Check table: TKA01 Conversion Routine: Domain Name: CACCD MemoryID: CAC AppClass: KS SHLP: SHLP Field: ConvExit: See all SAP tables containing field KOKRS
|
P_MCONSSFDWGR-SEGMENT table field - Segment for Segmental Reporting
▼
Description: Segment for Segmental Reporting Field Name: SEGMENT Data Element: FB_SEGMENT Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: FB_SEGMENT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field SEGMENT
|
P_MCONSSFDWGR-SCNTR table field - Sender cost center
▼
Description: Sender cost center Field Name: SCNTR Data Element: SKOST Data Type: CHAR length (Dec): 10(0) Check table: CSKS Conversion Routine: ALPHA Domain Name: KOSTL MemoryID: KSK AppClass: KA SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field SCNTR
|
P_MCONSSFDWGR-PPRCTR table field - Partner Profit Center
▼
Description: Partner Profit Center Field Name: PPRCTR Data Element: PPRCTR Data Type: CHAR length (Dec): 10(0) Check table: CEPC Conversion Routine: ALPHA Domain Name: PRCTR MemoryID: PPC AppClass: KE SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field PPRCTR
|
P_MCONSSFDWGR-SFAREA table field - Partner Functional Area
▼
Description: Partner Functional Area Field Name: SFAREA Data Element: SFKBER Data Type: CHAR length (Dec): 16(0) Check table: TFKB Conversion Routine: Domain Name: FKBER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SFAREA
|
P_MCONSSFDWGR-SBUSA table field - Trading partner's business area
▼
Description: Trading partner's business area Field Name: SBUSA Data Element: PARGB Data Type: CHAR length (Dec): 4(0) Check table: TGSB Conversion Routine: Domain Name: GSBER MemoryID: GSB AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field SBUSA
|
P_MCONSSFDWGR-RASSC table field - Company ID of Trading Partner
▼
Description: Company ID of Trading Partner Field Name: RASSC Data Element: RASSC Data Type: CHAR length (Dec): 6(0) Check table: T880 Conversion Routine: ALPHA Domain Name: RCOMP MemoryID: PGS AppClass: FGI SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field RASSC
|
P_MCONSSFDWGR-PSEGMENT table field - Partner Segment for Segmental Reporting
▼
Description: Partner Segment for Segmental Reporting Field Name: PSEGMENT Data Element: FB_PSEGMENT Data Type: CHAR length (Dec): 10(0) Check table: FAGL_SEGM Conversion Routine: ALPHA Domain Name: FB_SEGMENT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field PSEGMENT
|
P_MCONSSFDWGR-AUFNR table field - Order Number
▼
Description: Order Number Field Name: AUFNR Data Element: AUFNR Data Type: CHAR length (Dec): 12(0) Check table: AUFK Conversion Routine: ALPHA Domain Name: AUFNR MemoryID: ANR AppClass: SAP SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field AUFNR
|
P_MCONSSFDWGR-KUNNR table field - Customer Number
▼
Description: Customer Number Field Name: KUNNR Data Element: KUNNR Data Type: CHAR length (Dec): 10(0) Check table: KNA1 Conversion Routine: ALPHA Domain Name: KUNNR MemoryID: KUN AppClass: V SHLP: C_KUNNR SHLP Field: KUNNR ConvExit: ALPHA See all SAP tables containing field KUNNR
|
P_MCONSSFDWGR-LIFNR table field - Account Number of Supplier
▼
Description: Account Number of Supplier Field Name: LIFNR Data Element: LIFNR Data Type: CHAR length (Dec): 10(0) Check table: LFA1 Conversion Routine: ALPHA Domain Name: LIFNR MemoryID: LIF AppClass: FB SHLP: KRED_C SHLP Field: LIFNR ConvExit: ALPHA See all SAP tables containing field LIFNR
|
P_MCONSSFDWGR-MATNR table field - Material Number
▼
Description: Material Number Field Name: MATNR Data Element: MATNR Data Type: CHAR length (Dec): 40(0) Check table: MARA Conversion Routine: MATN1 Domain Name: MATNR MemoryID: MAT AppClass: MG SHLP: S_MAT1 SHLP Field: MATNR ConvExit: MATN1 See all SAP tables containing field MATNR
|
P_MCONSSFDWGR-MATKL_MM table field - Material Group
▼
Description: Material Group Field Name: MATKL_MM Data Element: FINS_MATKL_MM Data Type: CHAR length (Dec): 9(0) Check table: T023 Conversion Routine: Domain Name: MATKL MemoryID: AppClass: MG SHLP: S_WBWG SHLP Field: MATKL ConvExit: See all SAP tables containing field MATKL_MM
|
P_MCONSSFDWGR-WERKS table field - Plant
▼
Description: Plant Field Name: WERKS Data Element: WERKS_D Data Type: CHAR length (Dec): 4(0) Check table: T001W Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field WERKS
|
P_MCONSSFDWGR-RMVCT table field - Transaction type
▼
Description: Transaction type Field Name: RMVCT Data Element: RMVCT Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: RMVCT MemoryID: AppClass: FK SHLP: SHLP Field: ConvExit: See all SAP tables containing field RMVCT
|
P_MCONSSFDWGR-PS_PSP_PNR table field - Work Breakdown Structure Element (WBS Element)
▼
Description: Work Breakdown Structure Element (WBS Element) Field Name: PS_PSP_PNR Data Element: PS_PSP_PNR Data Type: NUMC length (Dec): 8(0) Check table: Conversion Routine: ABPSP Domain Name: PS_POSNR MemoryID: AppClass: CN SHLP: SHLP Field: ConvExit: ABPSP See all SAP tables containing field PS_PSP_PNR
|
P_MCONSSFDWGR-PS_POSID table field - Work Breakdown Structure Element (WBS Element)
▼
Description: Work Breakdown Structure Element (WBS Element) Field Name: PS_POSID Data Element: PS_POSID Data Type: CHAR length (Dec): 24(0) Check table: Conversion Routine: ABPSN Domain Name: PS_POSID MemoryID: PRO AppClass: CN SHLP: CC_PRPM SHLP Field: POSID ConvExit: ABPSN See all SAP tables containing field PS_POSID
|
P_MCONSSFDWGR-PS_PSPID table field - Project definition
▼
Description: Project definition Field Name: PS_PSPID Data Element: PS_PSPID Data Type: CHAR length (Dec): 24(0) Check table: Conversion Routine: ABPSN Domain Name: PS_PSPID MemoryID: PSP AppClass: CN SHLP: PD_DUMMY SHLP Field: PSPID ConvExit: ABPSN See all SAP tables containing field PS_PSPID
|
P_MCONSSFDWGR-FKART table field - Billing Type
▼
Description: Billing Type Field Name: FKART Data Element: FKART Data Type: CHAR length (Dec): 4(0) Check table: TVFK Conversion Routine: Domain Name: FKART MemoryID: AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field FKART
|
P_MCONSSFDWGR-VKORG table field - Sales Organization
▼
Description: Sales Organization Field Name: VKORG Data Element: VKORG Data Type: CHAR length (Dec): 4(0) Check table: TVKO Conversion Routine: Domain Name: VKORG MemoryID: VKO AppClass: MG SHLP: C_VKORG SHLP Field: VKORG ConvExit: See all SAP tables containing field VKORG
|
P_MCONSSFDWGR-VTWEG table field - Distribution Channel
▼
Description: Distribution Channel Field Name: VTWEG Data Element: VTWEG Data Type: CHAR length (Dec): 2(0) Check table: TVTW Conversion Routine: Domain Name: VTWEG MemoryID: VTW AppClass: MG SHLP: C_VTWEG SHLP Field: VTWEG ConvExit: See all SAP tables containing field VTWEG
|
P_MCONSSFDWGR-SPART table field - Division
▼
Description: Division Field Name: SPART Data Element: SPART Data Type: CHAR length (Dec): 2(0) Check table: TSPA Conversion Routine: Domain Name: SPART MemoryID: SPA AppClass: V SHLP: C_SPART SHLP Field: SPART ConvExit: See all SAP tables containing field SPART
|
P_MCONSSFDWGR-MATNR_COPA table field - Product Sold
▼
Description: Product Sold Field Name: MATNR_COPA Data Element: FINS_MATNR_PA Data Type: CHAR length (Dec): 40(0) Check table: MARA Conversion Routine: MATN1 Domain Name: MATNR MemoryID: MAT AppClass: MG SHLP: SHLP Field: ConvExit: MATN1 See all SAP tables containing field MATNR_COPA
|
P_MCONSSFDWGR-MATKL table field - Product Sold Group
▼
Description: Product Sold Group Field Name: MATKL Data Element: FINS_MATKL_PA Data Type: CHAR length (Dec): 9(0) Check table: T023 Conversion Routine: Domain Name: MATKL MemoryID: MKL AppClass: MG SHLP: S_WBWG SHLP Field: MATKL ConvExit: See all SAP tables containing field MATKL
|
P_MCONSSFDWGR-KDGRP table field - Customer Group
▼
Description: Customer Group Field Name: KDGRP Data Element: KDGRP Data Type: CHAR length (Dec): 2(0) Check table: T151 Conversion Routine: Domain Name: KDGRP MemoryID: VKD AppClass: V SHLP: SHLP Field: ConvExit: See all SAP tables containing field KDGRP
|
P_MCONSSFDWGR-LAND1 table field - Country/Region Key
▼
Description: Country/Region Key Field Name: LAND1 Data Element: LAND1_GP Data Type: CHAR length (Dec): 3(0) Check table: T005 Conversion Routine: Domain Name: LAND1 MemoryID: AppClass: SAP SHLP: C_LAND1 SHLP Field: LAND1 ConvExit: See all SAP tables containing field LAND1
|
P_MCONSSFDWGR-BRSCH table field - Industry key
▼
Description: Industry key Field Name: BRSCH Data Element: BRSCH Data Type: CHAR length (Dec): 4(0) Check table: T016 Conversion Routine: Domain Name: BRSCH MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field BRSCH
|
P_MCONSSFDWGR-BZIRK table field - Sales District
▼
Description: Sales District Field Name: BZIRK Data Element: BZIRK Data Type: CHAR length (Dec): 6(0) Check table: T171 Conversion Routine: Domain Name: BZIRK MemoryID: BZI AppClass: V SHLP: SHLP Field: ConvExit: See all SAP tables containing field BZIRK
|
P_MCONSSFDWGR-KUNRE table field - Bill-to Party
▼
Description: Bill-to Party Field Name: KUNRE Data Element: KUNRE Data Type: CHAR length (Dec): 10(0) Check table: KNA1 Conversion Routine: ALPHA Domain Name: KUNNR MemoryID: KUN AppClass: V SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field KUNRE
|
P_MCONSSFDWGR-KUNWE table field - Ship-to Party
▼
Description: Ship-to Party Field Name: KUNWE Data Element: KUNWE Data Type: CHAR length (Dec): 10(0) Check table: KNA1 Conversion Routine: ALPHA Domain Name: KUNNR MemoryID: AppClass: V SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field KUNWE
|
P_MCONSSFDWGR-KONZS table field - Group key
▼
Description: Group key Field Name: KONZS Data Element: KONZS Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: KONZS MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field KONZS
|
P_MCONSSFDWGR-CNSLDTNJRNLENTRYITEMORIGIN table field - Consolidation Journal Entry Item Origin
▼
Description: Consolidation Journal Entry Item Origin Field Name: CNSLDTNJRNLENTRYITEMORIGIN Data Element: FINCS_JRNL_ENTRY_ITEM_ORIGIN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FINCS_JRNL_ENTRY_ITEM_ORIGIN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNJRNLENTRYITEMORIGIN
|
P_MCONSSFDWGR-FINANCIALPLANNINGREQTRANSSQNC table field - Financial Planning Request Transaction Sequence Number
▼
Description: Financial Planning Request Transaction Sequence Number Field Name: FINANCIALPLANNINGREQTRANSSQNC Data Element: FIS_FP_REQUEST_TSN Data Type: NUMC length (Dec): 23(0) Check table: Conversion Routine: Domain Name: FIS_RSPM_TSN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FINANCIALPLANNINGREQTRANSSQNC
|
P_MCONSSFDWGR-FINANCIALPLANNINGDATAPACKET table field - Financial Planning Data Packet Number
▼
Description: Financial Planning Data Packet Number Field Name: FINANCIALPLANNINGDATAPACKET Data Element: FIS_FP_DATA_PACKET Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: NUM6 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field FINANCIALPLANNINGDATAPACKET
|
P_MCONSSFDWGR-FINANCIALPLANNINGENTRYITEM table field - Financial Planning Entry Item
▼
Description: Financial Planning Entry Item Field Name: FINANCIALPLANNINGENTRYITEM Data Element: FIS_FP_ENTRY_ITEM Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: RSNUMRECORD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FINANCIALPLANNINGENTRYITEM
|
P_MCONSSFDWGR-RLDNR_FIN table field - Ledger in General Ledger Accounting
▼
Description: Ledger in General Ledger Accounting Field Name: RLDNR_FIN Data Element: FINS_LEDGER Data Type: CHAR length (Dec): 2(0) Check table: FINSC_LEDGER Conversion Routine: ALPHA Domain Name: FINS_LEDGER MemoryID: GLN_FLEX AppClass: SHLP: FINS_LEDGER SHLP Field: RLDNR ConvExit: ALPHA See all SAP tables containing field RLDNR_FIN
|
P_MCONSSFDWGR-ADHOCITEM table field - Ad Hoc Item
▼
Description: Ad Hoc Item Field Name: ADHOCITEM Data Element: FINCS_ADHOCITEM Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: FINCS_ADHOCITEM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ADHOCITEM
|
P_MCONSSFDWGR-ADHOCSET table field - Ad Hoc Set
▼
Description: Ad Hoc Set Field Name: ADHOCSET Data Element: FINCS_ADHOCSET Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: FINCS_ADHOCSET MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ADHOCSET
|
P_MCONSSFDWGR-ADHOCSETITEM table field - Ad Hoc Set Item
▼
Description: Ad Hoc Set Item Field Name: ADHOCSETITEM Data Element: FINCS_ADHOCSETITEM Data Type: NUMC length (Dec): 8(0) Check table: Conversion Routine: Domain Name: FINCS_ADHOCSETITEM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ADHOCSETITEM
|
P_MCONSSFDWGR-RCODE table field - Reason Code
▼
Description: Reason Code Field Name: RCODE Data Element: ICA_RCODE Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: ICA_RCODE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RCODE
|
P_MCONSSFDWGR-ORIG_TYPE table field - Origin Type
▼
Description: Origin Type Field Name: ORIG_TYPE Data Element: FINCS_ORIG_TYPE Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: FINCS_ORIG_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORIG_TYPE
|
P_MCONSSFDWGR-ORIG_REF table field - Origin Reference
▼
Description: Origin Reference Field Name: ORIG_REF Data Element: FINCS_ORIG_REF Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: FINCS_ORIG_REF MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORIG_REF
|