SAP PCRVACTVDYNVAL table - Generated Table for View details in SAP
SAP PCRVACTVDYNVAL table summary
Warning: Undefined array key "id" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 101Object Name: PCRVACTVDYNVAL
Dictionary Type: Table view
Description: Generated Table for View
Field list for PCRVACTVDYNVAL table on an S/4 SAP system
Details |
PCRVACTVDYNVAL-MANDT table field - Client ▼Description: Client |
PCRVACTVDYNVAL-CMPLRQVERSUUID table field - Compliance Requirement UUID ▼Description: Compliance Requirement UUID |
PCRVACTVDYNVAL-CMPLRQVERSNAME table field - Compliance Requirement Name ▼Description: Compliance Requirement Name |
PCRVACTVDYNVAL-CMPLRQVERSACTVTNCHANGEDCODE table field - Description for a Change of a Compliance Requirement ▼Description: Description for a Change of a Compliance Requirement |
PCRVACTVDYNVAL-CMPLRQVERSACTIVATIONSTATUS table field - Activation Status of Compliance Requirement Version ▼Description: Activation Status of Compliance Requirement Version |
PCRVACTVDYNVAL-CMPLRQVERSACTIVATEDBYUSER table field - Activated By ▼Description: Activated By |
PCRVACTVDYNVAL-CMPLRQVERSACTIVATIONDATE table field - Activated On ▼Description: Activated On |
PCRVACTVDYNVAL-CMPLRQVERSDEACTIVATEDBYUSER table field - Deactivated By ▼Description: Deactivated By |
PCRVACTVDYNVAL-CMPLRQVERSDEACTIVATIONDATE table field - Deactivated On ▼Description: Deactivated On |
PCRVACTVDYNVAL-EFFECTIVEDATE table field - Effective Date ▼Description: Effective Date |
PCRVACTVDYNVAL-TRANSITIONPERIODENDDATE table field - End of Transition of a Compliance Requirement ▼Description: End of Transition of a Compliance Requirement |
PCRVACTVDYNVAL-CMPLRQVERSBUILDDATE table field - Compliance Requirement Build Date ▼Description: Compliance Requirement Build Date |
PCRVACTVDYNVAL-CONTENTPROVIDER table field - Content Provider ▼Description: Content Provider |
PCRVACTVDYNVAL-CMPLRQPATTERN table field - ▼Description: |
PCRVACTVDYNVAL-COMPLIANCEREQUIREMENT table field - Compliance Requirement ▼Description: Compliance Requirement |
PCRVACTVDYNVAL-CMPLRQAPPLICATIONCOMPONENT table field - Solution Area ▼Description: Solution Area |
PCRVACTVDYNVAL-CMPLRQISUSEDINCHMLCMPLNCINFO table field - Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') ▼Description: Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') |
PCRVACTVDYNVAL-CMPLRQVERSHASACTIVESUCCESSOR table field - Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') ▼Description: Data element for domain BOOLE: TRUE (='X') and FALSE (=' ') |
PCRVACTVDYNVAL-VALIDITYENDDATE table field - Expiration Date ▼Description: Expiration Date |
PCRVACTVDYNVAL-CHMLCOMPOSITIONTYPE table field - Legal Area ▼Description: Legal Area |
PCRVACTVDYNVAL-CMPLRQVERSNAMEINCURLANG table field - Compliance Requirement Name ▼Description: Compliance Requirement Name |
PCRVACTVDYNVAL-CMPLRQVERSENGLISHNAME table field - Compliance Requirement Name ▼Description: Compliance Requirement Name |
Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 234 Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 278 Warning: Undefined variable $obj1 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj2 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj3 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj4 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj5 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj6 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj7 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj8 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj9 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj10 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj11 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
View list of all SAP tables(S4H/ECC)
Select data from SAP table