SAP PMRHIERNADDKF table - Generated Table for View details in SAP
SAP PMRHIERNADDKF table summary
Warning: Undefined array key "id" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 101Object Name: PMRHIERNADDKF
Dictionary Type: Table view
Description: Generated Table for View
Field list for PMRHIERNADDKF table on an S/4 SAP system
Details |
PMRHIERNADDKF-MANDT table field - Client ▼Description: Client |
PMRHIERNADDKF-KEYDATE table field - ▼Description: |
PMRHIERNADDKF-RISKANALYZERPORTFOLIOHIERARCHY table field - Portfolio Hierarchy ▼Description: Portfolio Hierarchy |
PMRHIERNADDKF-PARENTHIERARCHYNODE table field - Internal: Node ID ▼Description: Internal: Node ID |
PMRHIERNADDKF-RISKANALYZERKEYFIGURE table field - Key Figure ▼Description: Key Figure |
PMRHIERNADDKF-AUTHORIZATIONGROUP table field - Authorization Group ▼Description: Authorization Group |
PMRHIERNADDKF-PORTFOLIOHIERARCHYNODE table field - Node in Portfolio Hierarchy ▼Description: Node in Portfolio Hierarchy |
PMRHIERNADDKF-RISKANALYZERKEYFIGUREVALUE table field - Key Figure Value in Results Databases ▼Description: Key Figure Value in Results Databases |
PMRHIERNADDKF-CHARACTERISTICINTERNALID table field - Field Name ▼Description: Field Name |
PMRHIERNADDKF-CHARACTERISTICVALUE table field - Lower Limit of Characteristic Value ▼Description: Lower Limit of Characteristic Value |
PMRHIERNADDKF-DATAELEMENT table field - Data element (semantic domain) ▼Description: Data element (semantic domain) |
PMRHIERNADDKF-STATUSCODE table field - ▼Description: |
Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 234 Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 278 Warning: Undefined variable $obj1 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj2 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj3 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj4 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj5 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj6 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj7 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj8 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj9 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj10 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj11 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
View list of all SAP tables(S4H/ECC)
Select data from SAP table