SAP PPROJBYMANAGELI table - Generated Table for View details in SAP
SAP PPROJBYMANAGELI table summary
Warning: Undefined array key "id" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 101Object Name: PPROJBYMANAGELI
Dictionary Type: Table view
Description: Generated Table for View
Field list for PPROJBYMANAGELI table on an S/4 SAP system
Details |
PPROJBYMANAGELI-MANDT table field - Client ▼Description: Client |
PPROJBYMANAGELI-PROJECT table field - Project Number (External) Edited ▼Description: Project Number (External) Edited |
PPROJBYMANAGELI-SOURCELEDGER table field - Source Ledger ▼Description: Source Ledger |
PPROJBYMANAGELI-LEDGER table field - Ledger in General Ledger Accounting ▼Description: Ledger in General Ledger Accounting |
PPROJBYMANAGELI-FISCALYEAR table field - Fiscal Year ▼Description: Fiscal Year |
PPROJBYMANAGELI-ACCOUNTINGDOCUMENT table field - Journal Entry ▼Description: Journal Entry |
PPROJBYMANAGELI-FINANCIALPLANNINGREQTRANSSQNC table field - Financial Planning Request Transaction Sequence Number ▼Description: Financial Planning Request Transaction Sequence Number |
PPROJBYMANAGELI-FINANCIALPLANNINGDATAPACKET table field - Financial Planning Data Packet Number ▼Description: Financial Planning Data Packet Number |
PPROJBYMANAGELI-ACTUALPLANJOURNALENTRYITEM table field - Actual Plan Journal Entry Item ▼Description: Actual Plan Journal Entry Item |
PPROJBYMANAGELI-PROJECTINTERNALID table field - Project (internal) ▼Description: Project (internal) |
PPROJBYMANAGELI-GLACCOUNTHIERARCHY table field - Financial Statement Version ▼Description: Financial Statement Version |
PPROJBYMANAGELI-ISSETTLED table field - ▼Description: |
PPROJBYMANAGELI-WBSELEMENTINTERNALID table field - WBS Element Internal ID ▼Description: WBS Element Internal ID |
PPROJBYMANAGELI-PLANNINGCATEGORY table field - Plan Category ▼Description: Plan Category |
PPROJBYMANAGELI-SEMANTICTAG table field - Semantic Tag of a Hierarchy Node ▼Description: Semantic Tag of a Hierarchy Node |
PPROJBYMANAGELI-POSTINGDATE table field - Posting Date ▼Description: Posting Date |
PPROJBYMANAGELI-CREATIONDATE table field - Creation Date ▼Description: Creation Date |
PPROJBYMANAGELI-GLOBALCURRENCY table field - Global Currency ▼Description: Global Currency |
PPROJBYMANAGELI-AMOUNTINGLOBALCURRENCY table field - Amount in Global Currency ▼Description: Amount in Global Currency |
PPROJBYMANAGELI-CONTROLLINGOBJECTCURRENCY table field - CO Object Currency ▼Description: CO Object Currency |
PPROJBYMANAGELI-AMOUNTINOBJECTCURRENCY table field - Amount in Object Currency ▼Description: Amount in Object Currency |
Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 234 Warning: Undefined variable $ucsaptab in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 278 Warning: Undefined variable $obj1 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj2 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj3 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj4 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj5 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj6 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj7 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj8 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj9 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj10 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279 Warning: Undefined variable $obj11 in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 279
View list of all SAP tables(S4H/ECC)
Select data from SAP table